Detailed information NTG0822298

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: QFX48_RS07640
• Genome accession: NZ_CP123746
• Coordinates: 1578337..1578648 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain 1.3
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1573337..1583648

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QFX48_RS07605	gcvPA	1573839..1575185 (-)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
QFX48_RS07610	gcvT	1575205..1576296 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
QFX48_RS07615	-	1576455..1576979 (-)	525	WP_001015117.1	shikimate kinase	-
QFX48_RS07620	-	1576969..1577115 (-)	147	WP_001789879.1	hypothetical protein	-
QFX48_RS07625	comGF	1577212..1577709 (-)	498	WP_304984668.1	competence type IV pilus minor pilin ComGF	Machinery gene
QFX48_RS07630	comGE	1577627..1577926 (-)	300	WP_304984667.1	competence protein ComGE	Machinery gene
QFX48_RS07635	comGD	1577913..1578359 (-)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
QFX48_RS07640	comGC	1578337..1578648 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
QFX48_RS07645	comGB	1578662..1579732 (-)	1071	WP_000775708.1	competence type IV pilus assembly protein ComGB	Machinery gene
QFX48_RS07650	comGA	1579704..1580678 (-)	975	WP_000697228.1	competence type IV pilus ATPase ComGA	Machinery gene
QFX48_RS07655	-	1580730..1581353 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
QFX48_RS07660	-	1581350..1581679 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
QFX48_RS07665	-	1581679..1582665 (-)	987	WP_000161314.1	ROK family glucokinase	-
QFX48_RS07670	-	1582662..1582865 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=822298 QFX48_RS07640 WP_000472256.1 1578337..1578648(-) (comGC) [Staphylococcus aureus strain 1.3]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=822298 QFX48_RS07640 WP_000472256.1 1578337..1578648(-) (comGC) [Staphylococcus aureus strain 1.3]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369