Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | QAY63_RS08945 | Genome accession | NZ_CP123080 |
| Coordinates | 1746764..1747189 (-) | Length | 141 a.a. |
| NCBI ID | WP_015978401.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain SW-MRSA59 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1707057..1754114 | 1746764..1747189 | within | 0 |
Gene organization within MGE regions
Location: 1707057..1754114
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QAY63_RS08660 (QAY63_08675) | - | 1707057..1707353 (-) | 297 | WP_000447709.1 | DUF4176 domain-containing protein | - |
| QAY63_RS08665 (QAY63_08680) | - | 1707341..1707709 (-) | 369 | WP_000066369.1 | hypothetical protein | - |
| QAY63_RS08670 (QAY63_08685) | - | 1707724..1708002 (-) | 279 | WP_020977619.1 | TIGR04197 family type VII secretion effector | - |
| QAY63_RS08675 (QAY63_08690) | - | 1708148..1708963 (-) | 816 | WP_000160701.1 | AAA family ATPase | - |
| QAY63_RS08680 (QAY63_08695) | - | 1708956..1710398 (-) | 1443 | WP_031870354.1 | Mu transposase C-terminal domain-containing protein | - |
| QAY63_RS08685 (QAY63_08700) | - | 1710370..1710963 (-) | 594 | WP_000690628.1 | recombinase family protein | - |
| QAY63_RS08690 (QAY63_08705) | - | 1711169..1711711 (+) | 543 | WP_411888865.1 | TetR/AcrR family transcriptional regulator | - |
| QAY63_RS08695 (QAY63_08710) | - | 1712339..1713784 (-) | 1446 | WP_001148121.1 | SH3 domain-containing protein | - |
| QAY63_RS08700 (QAY63_08715) | - | 1713765..1714202 (-) | 438 | WP_031807125.1 | phage holin | - |
| QAY63_RS08705 (QAY63_08720) | - | 1714257..1714652 (-) | 396 | WP_000387943.1 | hypothetical protein | - |
| QAY63_RS08710 (QAY63_08725) | - | 1714657..1715895 (-) | 1239 | WP_000276650.1 | BppU family phage baseplate upper protein | - |
| QAY63_RS08715 (QAY63_08730) | - | 1715908..1717812 (-) | 1905 | WP_031895302.1 | glucosaminidase domain-containing protein | - |
| QAY63_RS08720 (QAY63_08735) | - | 1717949..1718248 (-) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| QAY63_RS08725 (QAY63_08740) | - | 1718289..1718462 (-) | 174 | WP_001790193.1 | XkdX family protein | - |
| QAY63_RS08730 (QAY63_08745) | - | 1718466..1718843 (-) | 378 | WP_000705893.1 | DUF2977 domain-containing protein | - |
| QAY63_RS08735 (QAY63_08750) | - | 1718843..1720666 (-) | 1824 | WP_411888866.1 | phage baseplate upper protein | - |
| QAY63_RS08740 (QAY63_08755) | - | 1720666..1722576 (-) | 1911 | WP_411888867.1 | hypothetical protein | - |
| QAY63_RS08745 (QAY63_08760) | - | 1722591..1724492 (-) | 1902 | WP_009560293.1 | SGNH/GDSL hydrolase family protein | - |
| QAY63_RS08750 (QAY63_08765) | - | 1724501..1725448 (-) | 948 | WP_000350680.1 | phage tail family protein | - |
| QAY63_RS08755 (QAY63_08770) | - | 1725461..1728925 (-) | 3465 | WP_411888868.1 | hypothetical protein | - |
| QAY63_RS08760 (QAY63_08775) | - | 1728942..1729286 (-) | 345 | WP_000105584.1 | hypothetical protein | - |
| QAY63_RS08765 (QAY63_08780) | - | 1729316..1729681 (-) | 366 | WP_001100163.1 | tail assembly chaperone | - |
| QAY63_RS08770 (QAY63_08785) | - | 1729743..1730324 (-) | 582 | WP_000002583.1 | phage major tail protein, TP901-1 family | - |
| QAY63_RS08775 (QAY63_08790) | - | 1730343..1730726 (-) | 384 | WP_000188653.1 | hypothetical protein | - |
| QAY63_RS08780 (QAY63_08795) | - | 1730738..1731085 (-) | 348 | WP_001017811.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| QAY63_RS08785 (QAY63_08800) | - | 1731085..1731387 (-) | 303 | WP_001268304.1 | hypothetical protein | - |
| QAY63_RS08790 (QAY63_08805) | - | 1731384..1731716 (-) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| QAY63_RS08795 (QAY63_08810) | - | 1731725..1732012 (-) | 288 | WP_001114086.1 | hypothetical protein | - |
| QAY63_RS08800 (QAY63_08815) | - | 1732034..1733008 (-) | 975 | WP_000438495.1 | phage major capsid protein | - |
| QAY63_RS08805 (QAY63_08820) | - | 1733022..1733636 (-) | 615 | WP_009560326.1 | DUF4355 domain-containing protein | - |
| QAY63_RS08810 (QAY63_08825) | - | 1733771..1733941 (-) | 171 | WP_000072207.1 | hypothetical protein | - |
| QAY63_RS08815 (QAY63_08830) | - | 1734014..1735009 (-) | 996 | WP_001133043.1 | minor capsid protein | - |
| QAY63_RS08820 (QAY63_08835) | - | 1735016..1736551 (-) | 1536 | WP_000921892.1 | phage portal protein | - |
| QAY63_RS08825 (QAY63_08840) | - | 1736562..1737857 (-) | 1296 | WP_031895294.1 | PBSX family phage terminase large subunit | - |
| QAY63_RS08830 (QAY63_08845) | - | 1737860..1738354 (-) | 495 | WP_001004406.1 | terminase small subunit | - |
| QAY63_RS08835 (QAY63_08850) | - | 1738541..1738960 (-) | 420 | WP_000058633.1 | transcriptional regulator | - |
| QAY63_RS08840 (QAY63_08855) | - | 1738975..1739121 (-) | 147 | WP_000989997.1 | hypothetical protein | - |
| QAY63_RS08845 (QAY63_08860) | rinB | 1739122..1739295 (-) | 174 | WP_031895293.1 | transcriptional activator RinB | - |
| QAY63_RS08850 (QAY63_08865) | - | 1739288..1739491 (-) | 204 | WP_001072794.1 | hypothetical protein | - |
| QAY63_RS08855 (QAY63_08870) | - | 1739488..1739682 (-) | 195 | WP_000132920.1 | hypothetical protein | - |
| QAY63_RS08860 (QAY63_08875) | - | 1739679..1739885 (-) | 207 | WP_000195785.1 | DUF1381 domain-containing protein | - |
| QAY63_RS08865 (QAY63_08880) | - | 1739922..1740452 (-) | 531 | WP_000185651.1 | dUTP diphosphatase | - |
| QAY63_RS08870 (QAY63_08885) | - | 1740445..1740627 (-) | 183 | WP_000028421.1 | hypothetical protein | - |
| QAY63_RS08875 (QAY63_08890) | - | 1740617..1740868 (-) | 252 | WP_031766094.1 | DUF1024 family protein | - |
| QAY63_RS08880 (QAY63_08895) | - | 1740861..1741145 (-) | 285 | WP_001105618.1 | hypothetical protein | - |
| QAY63_RS08885 (QAY63_08900) | - | 1741142..1741543 (-) | 402 | WP_411888869.1 | hypothetical protein | - |
| QAY63_RS08890 (QAY63_08905) | - | 1741556..1741804 (-) | 249 | WP_411888870.1 | phi PVL orf 51-like protein | - |
| QAY63_RS08895 (QAY63_08910) | - | 1741805..1742164 (-) | 360 | WP_031895324.1 | SA1788 family PVL leukocidin-associated protein | - |
| QAY63_RS08900 (QAY63_08915) | - | 1742165..1742350 (-) | 186 | WP_001187264.1 | DUF3113 family protein | - |
| QAY63_RS08905 (QAY63_08920) | - | 1742350..1742757 (-) | 408 | WP_000401950.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QAY63_RS08910 (QAY63_08925) | - | 1742767..1742988 (-) | 222 | WP_001123688.1 | DUF3269 family protein | - |
| QAY63_RS08915 (QAY63_08930) | - | 1743001..1743159 (-) | 159 | WP_000256596.1 | hypothetical protein | - |
| QAY63_RS08920 (QAY63_08935) | - | 1743153..1743932 (-) | 780 | WP_000803062.1 | ATP-binding protein | - |
| QAY63_RS08925 (QAY63_08940) | - | 1743942..1744712 (-) | 771 | WP_000190223.1 | conserved phage C-terminal domain-containing protein | - |
| QAY63_RS08930 (QAY63_08945) | - | 1744758..1745417 (+) | 660 | WP_016028252.1 | hypothetical protein | - |
| QAY63_RS08935 (QAY63_08950) | - | 1745527..1746201 (-) | 675 | WP_411888871.1 | putative HNHc nuclease | - |
| QAY63_RS08940 (QAY63_08955) | - | 1746202..1746753 (-) | 552 | WP_031927924.1 | NUMOD4 domain-containing protein | - |
| QAY63_RS08945 (QAY63_08960) | ssbA | 1746764..1747189 (-) | 426 | WP_015978401.1 | single-stranded DNA-binding protein | Machinery gene |
| QAY63_RS08950 (QAY63_08965) | - | 1747189..1747812 (-) | 624 | WP_000139720.1 | DUF1071 domain-containing protein | - |
| QAY63_RS08955 (QAY63_08970) | - | 1747805..1748026 (-) | 222 | WP_000815400.1 | DUF2483 family protein | - |
| QAY63_RS08960 (QAY63_08975) | - | 1748036..1748296 (-) | 261 | WP_000291089.1 | DUF1108 family protein | - |
| QAY63_RS08965 (QAY63_08980) | - | 1748390..1748551 (-) | 162 | WP_000066026.1 | DUF1270 family protein | - |
| QAY63_RS08970 (QAY63_08985) | - | 1748544..1748681 (-) | 138 | WP_000230552.1 | hypothetical protein | - |
| QAY63_RS08975 (QAY63_08990) | - | 1748731..1748961 (+) | 231 | WP_000395457.1 | hypothetical protein | - |
| QAY63_RS08980 (QAY63_08995) | - | 1748936..1749112 (-) | 177 | WP_172844570.1 | hypothetical protein | - |
| QAY63_RS08985 (QAY63_09000) | - | 1749128..1749880 (-) | 753 | WP_023487064.1 | phage antirepressor KilAC domain-containing protein | - |
| QAY63_RS08990 (QAY63_09005) | - | 1749882..1750067 (-) | 186 | WP_000933363.1 | helix-turn-helix domain-containing protein | - |
| QAY63_RS08995 (QAY63_09010) | - | 1750507..1750716 (+) | 210 | WP_000642492.1 | hypothetical protein | - |
| QAY63_RS09000 (QAY63_09015) | - | 1750706..1750849 (-) | 144 | WP_000939498.1 | hypothetical protein | - |
| QAY63_RS09005 (QAY63_09020) | - | 1750864..1751307 (-) | 444 | WP_000435360.1 | hypothetical protein | - |
| QAY63_RS09010 (QAY63_09025) | - | 1751325..1751549 (-) | 225 | WP_000333485.1 | DUF739 family protein | - |
| QAY63_RS09015 (QAY63_09030) | - | 1751711..1752091 (+) | 381 | WP_411888872.1 | helix-turn-helix domain-containing protein | - |
| QAY63_RS09020 (QAY63_09035) | - | 1752113..1752409 (+) | 297 | Protein_1750 | toxin | - |
| QAY63_RS09025 (QAY63_09040) | - | 1752510..1754114 (-) | 1605 | WP_000284571.1 | IS1182-like element IS1182 family transposase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15947.45 Da Isoelectric Point: 5.8790
>NTDB_id=818310 QAY63_RS08945 WP_015978401.1 1746764..1747189(-) (ssbA) [Staphylococcus aureus strain SW-MRSA59]
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
MLNRTVLVGRLTKDPEYRTTPNGVSVTTFTIAVNRTFTNAQGEREADFINCVTFRKQAENVNNYLSKGSLAGVDGRLQSR
SYENKDGQRVFVTEVVADSVQFLEPKNNNQQPNNNYHQQRQTQTGNNPFDNNADSIEDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=818310 QAY63_RS08945 WP_015978401.1 1746764..1747189(-) (ssbA) [Staphylococcus aureus strain SW-MRSA59]
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
ATGTTAAATAGAACAGTATTAGTAGGACGCTTAACAAAAGATCCAGAATATAGAACAACGCCAAATGGTGTGAGTGTTAC
CACTTTCACTATCGCAGTTAACAGAACATTTACTAACGCTCAAGGAGAACGTGAGGCAGACTTTATTAACTGTGTAACTT
TTAGAAAACAAGCAGAAAATGTAAATAATTATTTATCCAAAGGGTCATTGGCTGGCGTTGATGGACGTTTACAATCACGC
AGTTATGAAAACAAAGACGGGCAACGTGTATTTGTCACAGAAGTAGTAGCGGACAGTGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAACAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAACAACGCAG
ACTCTATAGAGGATCTTCCTTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
74.576 |
83.688 |
0.624 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.603 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
75.177 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.553 |
100 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
41.844 |
100 |
0.418 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.763 |
83.688 |
0.383 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.915 |
83.688 |
0.376 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.915 |
83.688 |
0.376 |