NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	QA594_RS09895	Genome accession	NZ_CP121518
Coordinates	2085639..2085956 (-)	Length	105 a.a.
NCBI ID	WP_001831271.1	Uniprot ID	A0A9Q5JKE9
Organism	Staphylococcus epidermidis strain 6DSE07
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2080639..2090956

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
QA594_RS09865	gcvPA	2081165..2082511 (-)	1347	WP_099797722.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
QA594_RS09870	gcvT	2082531..2083622 (-)	1092	WP_099797720.1	glycine cleavage system aminomethyltransferase GcvT	-
QA594_RS09875	-	2083840..2084352 (-)	513	WP_002497929.1	shikimate kinase	-
QA594_RS09880	-	2084517..2085008 (-)	492	WP_002440043.1	competence type IV pilus minor pilin ComGF	-
QA594_RS09885	-	2084932..2085225 (-)	294	WP_099797718.1	hypothetical protein	-
QA594_RS09890	comGD	2085212..2085649 (-)	438	WP_001831025.1	competence type IV pilus minor pilin ComGD	-
QA594_RS09895	comGC	2085639..2085956 (-)	318	WP_001831271.1	competence type IV pilus major pilin ComGC	Machinery gene
QA594_RS09900	comGB	2085974..2087041 (-)	1068	WP_024051203.1	competence type IV pilus assembly protein ComGB	Machinery gene
QA594_RS09905	comGA	2087013..2087987 (-)	975	WP_024051204.1	competence type IV pilus ATPase ComGA	Machinery gene
QA594_RS09910	-	2088043..2088666 (-)	624	WP_002446535.1	MBL fold metallo-hydrolase	-
QA594_RS09915	-	2088666..2088992 (-)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
QA594_RS09920	-	2088992..2089978 (-)	987	WP_001831113.1	ROK family glucokinase	-
QA594_RS09925	-	2089978..2090178 (-)	201	WP_001831138.1	YqgQ family protein	-

Sequence

Protein

Download Length: 105 a.a. Molecular weight: 11491.58 Da Isoelectric Point: 9.7429

                                >NTDB_id=812695 QA594_RS09895 WP_001831271.1 2085639..2085956(-) (comGC) [Staphylococcus epidermidis strain 6DSE07]

MKTLKLLKKTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIDDLVSDG

FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

Download Length: 318 bp

                                >NTDB_id=812695 QA594_RS09895 WP_001831271.1 2085639..2085956(-) (comGC) [Staphylococcus epidermidis strain 6DSE07]

ATGAAAACATTGAAATTATTGAAAAAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATAAGTTT

ATTGTTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA

TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAGCATAATCGCAACCCTTCTAATATTGATGATTTGGTTTCAGATGGT

TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAGGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(8-32)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	87.255	97.143	0.848
comGC	Staphylococcus aureus N315	87.255	97.143	0.848
comGC/cglC	Streptococcus mitis SK321	44.66	98.095	0.438
comGC/cglC	Streptococcus pneumoniae TIGR4	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae D39	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae R6	44.681	89.524	0.4
comYC	Streptococcus mutans UA159	47.674	81.905	0.39
comYC	Streptococcus mutans UA140	47.674	81.905	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC	Lactococcus lactis subsp. cremoris KW2	47.561	78.095	0.371
comGC/cglC	Streptococcus mitis NCTC 12261	50	74.286	0.371
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362

Detailed information NTG0812695