NTDB

Overview

Name	comGC/cglC	Type	Machinery gene
Locus tag	P8P68_RS06270	Genome accession	NZ_CP121467
Coordinates	1292126..1292449 (-)	Length	107 a.a.
NCBI ID	WP_000735798.1	Uniprot ID	A0A1X1HB54
Organism	Streptococcus sp. D7B5
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1287126..1297449

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
P8P68_RS06235 (P8P68_06235)	-	1288024..1288611 (+)	588	WP_084851076.1	Ltp family lipoprotein	-
P8P68_RS06240 (P8P68_06240)	-	1288685..1289996 (+)	1312	Protein_1197	IS3 family transposase	-
P8P68_RS06245 (P8P68_06245)	-	1289990..1290616 (-)	627	WP_278275776.1	class I SAM-dependent methyltransferase	-
P8P68_RS06250 (P8P68_06250)	comGG/cglG	1290649..1291062 (-)	414	WP_049490203.1	competence type IV pilus minor pilin ComGG	Machinery gene
P8P68_RS06255 (P8P68_06255)	comGF/cglF	1291040..1291501 (-)	462	WP_049490202.1	competence type IV pilus minor pilin ComGF	Machinery gene
P8P68_RS06260 (P8P68_06260)	comGE/cglE	1291464..1291766 (-)	303	WP_000413367.1	competence type IV pilus minor pilin ComGE	Machinery gene
P8P68_RS06265 (P8P68_06265)	comGD/cglD	1291729..1292163 (-)	435	WP_049519116.1	competence type IV pilus minor pilin ComGD	Machinery gene
P8P68_RS06270 (P8P68_06270)	comGC/cglC	1292126..1292449 (-)	324	WP_000735798.1	competence type IV pilus major pilin ComGC	Machinery gene
P8P68_RS06275 (P8P68_06275)	comGB/cglB	1292451..1293467 (-)	1017	WP_000355379.1	competence type IV pilus assembly protein ComGB	Machinery gene
P8P68_RS06280 (P8P68_06280)	comGA/cglA/cilD	1293415..1294356 (-)	942	WP_000249575.1	competence type IV pilus ATPase ComGA	Machinery gene
P8P68_RS06285 (P8P68_06285)	-	1294426..1294791 (-)	366	WP_000286396.1	DUF1033 family protein	-
P8P68_RS06290 (P8P68_06290)	nagA	1294946..1296097 (-)	1152	WP_001134447.1	N-acetylglucosamine-6-phosphate deacetylase	-

Sequence

Protein

Download Length: 107 a.a. Molecular weight: 11891.03 Da Isoelectric Point: 10.1883

                                >NTDB_id=812235 P8P68_RS06270 WP_000735798.1 1292126..1292449(-) (comGC/cglC) [Streptococcus sp. D7B5]

MKKLMTNLKKAKVKAFTLVEMLVVLLIISVLLLLFVPNLTKQKDAVDDKGKAAVVKVVESQAELYRLDKNDDASLSKLQA

DGRITAEQAKAYKDYHAKQKTSQTVAD

Nucleotide

Download Length: 324 bp

                                >NTDB_id=812235 P8P68_RS06270 WP_000735798.1 1292126..1292449(-) (comGC/cglC) [Streptococcus sp. D7B5]

ATGAAAAAACTCATGACAAATTTAAAAAAAGCCAAGGTTAAAGCTTTCACTTTGGTAGAAATGTTAGTGGTCTTGCTCAT

CATCAGCGTTCTTCTCTTGCTCTTTGTACCCAATTTGACCAAGCAAAAGGATGCCGTAGATGATAAAGGAAAAGCTGCTG

TTGTCAAGGTCGTGGAAAGCCAGGCAGAACTTTATCGTTTGGATAAAAATGATGATGCCAGCCTCAGCAAATTACAAGCG

GACGGTCGTATCACAGCTGAGCAAGCTAAAGCTTACAAAGACTACCATGCAAAACAAAAAACCAGTCAAACTGTTGCAGA

TTAA

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(11-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A1X1HB54

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC/cglC	Streptococcus mitis NCTC 12261	91.589	100	0.916
comGC/cglC	Streptococcus mitis SK321	88.889	92.523	0.822
comGC/cglC	Streptococcus pneumoniae R6	86.869	92.523	0.804
comGC/cglC	Streptococcus pneumoniae Rx1	86.869	92.523	0.804
comGC/cglC	Streptococcus pneumoniae D39	86.869	92.523	0.804
comGC/cglC	Streptococcus pneumoniae TIGR4	85.859	92.523	0.794
comYC	Streptococcus gordonii str. Challis substr. CH1	67.619	98.131	0.664
comYC	Streptococcus mutans UA140	70.103	90.654	0.636
comYC	Streptococcus mutans UA159	70.103	90.654	0.636
comGC	Lactococcus lactis subsp. cremoris KW2	57.426	94.393	0.542
comYC	Streptococcus suis isolate S10	65.909	82.243	0.542

Detailed information NTG0812235