Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | P8191_RS10065 | Genome accession | NZ_CP121250 |
| Coordinates | 1957118..1957543 (+) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 1044 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1947762..1988987 | 1957118..1957543 | within | 0 |
Gene organization within MGE regions
Location: 1947762..1988987
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P8191_RS09985 (P8191_09985) | - | 1947762..1948928 (-) | 1167 | WP_011018152.1 | site-specific integrase | - |
| P8191_RS09990 (P8191_09990) | - | 1949110..1950531 (-) | 1422 | WP_014635616.1 | DUF4041 domain-containing protein | - |
| P8191_RS09995 (P8191_09995) | - | 1950546..1950932 (-) | 387 | WP_023605207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| P8191_RS10000 (P8191_10000) | - | 1950916..1951257 (-) | 342 | WP_011888679.1 | helix-turn-helix transcriptional regulator | - |
| P8191_RS10005 (P8191_10005) | - | 1951455..1951667 (+) | 213 | WP_014635614.1 | DNA-binding protein | - |
| P8191_RS10010 (P8191_10010) | - | 1951695..1952414 (+) | 720 | WP_011888681.1 | phage antirepressor KilAC domain-containing protein | - |
| P8191_RS10015 (P8191_10015) | - | 1952512..1952751 (-) | 240 | WP_011284879.1 | hypothetical protein | - |
| P8191_RS10020 (P8191_10020) | - | 1952918..1953103 (+) | 186 | WP_011054585.1 | helix-turn-helix transcriptional regulator | - |
| P8191_RS10025 (P8191_10025) | - | 1953174..1953425 (+) | 252 | WP_011888682.1 | hypothetical protein | - |
| P8191_RS10030 (P8191_10030) | - | 1953456..1953593 (+) | 138 | WP_011017881.1 | hypothetical protein | - |
| P8191_RS10035 (P8191_10035) | - | 1953687..1954448 (+) | 762 | WP_014635613.1 | DnaD domain protein | - |
| P8191_RS10040 (P8191_10040) | - | 1954435..1955217 (+) | 783 | WP_011888684.1 | ATP-binding protein | - |
| P8191_RS10045 (P8191_10045) | - | 1955358..1955711 (+) | 354 | WP_011285579.1 | hypothetical protein | - |
| P8191_RS10050 (P8191_10050) | - | 1955692..1955946 (+) | 255 | WP_011018143.1 | hypothetical protein | - |
| P8191_RS10055 (P8191_10055) | - | 1955968..1956450 (+) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| P8191_RS10060 (P8191_10060) | - | 1956451..1957125 (+) | 675 | WP_029714396.1 | ERF family protein | - |
| P8191_RS10065 (P8191_10065) | ssb | 1957118..1957543 (+) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| P8191_RS10070 (P8191_10070) | - | 1957549..1957752 (+) | 204 | WP_011106686.1 | hypothetical protein | - |
| P8191_RS10075 (P8191_10075) | - | 1957752..1958192 (+) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P8191_RS10080 (P8191_10080) | - | 1958189..1958545 (+) | 357 | WP_011284873.1 | hypothetical protein | - |
| P8191_RS10405 | - | 1958542..1958787 (+) | 246 | WP_011285573.1 | hypothetical protein | - |
| P8191_RS10085 (P8191_10085) | - | 1958787..1959023 (+) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| P8191_RS10090 (P8191_10090) | - | 1959020..1959190 (+) | 171 | WP_002995952.1 | hypothetical protein | - |
| P8191_RS10095 (P8191_10095) | - | 1959187..1959471 (+) | 285 | WP_011018134.1 | hypothetical protein | - |
| P8191_RS10100 (P8191_10100) | - | 1959473..1960105 (+) | 633 | WP_011888685.1 | N-6 DNA methylase | - |
| P8191_RS10105 (P8191_10105) | - | 1960110..1960589 (+) | 480 | WP_011888686.1 | DUF1642 domain-containing protein | - |
| P8191_RS10110 (P8191_10110) | - | 1960586..1960756 (+) | 171 | WP_002987493.1 | hypothetical protein | - |
| P8191_RS10115 (P8191_10115) | - | 1961040..1961474 (+) | 435 | WP_011888687.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| P8191_RS10120 (P8191_10120) | - | 1962108..1963274 (+) | 1167 | Protein_1942 | DNA modification methylase | - |
| P8191_RS10125 (P8191_10125) | - | 1963617..1964093 (+) | 477 | WP_010922073.1 | hypothetical protein | - |
| P8191_RS10130 (P8191_10130) | - | 1964176..1965387 (+) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| P8191_RS10135 (P8191_10135) | - | 1965401..1966903 (+) | 1503 | WP_010922075.1 | phage portal protein | - |
| P8191_RS10140 (P8191_10140) | - | 1966908..1968401 (+) | 1494 | WP_029714379.1 | phage minor capsid protein | - |
| P8191_RS10145 (P8191_10145) | - | 1968401..1968628 (+) | 228 | WP_010922077.1 | hypothetical protein | - |
| P8191_RS10150 (P8191_10150) | - | 1968715..1968981 (+) | 267 | WP_011888689.1 | hypothetical protein | - |
| P8191_RS10155 (P8191_10155) | - | 1969107..1969721 (+) | 615 | WP_011888690.1 | hypothetical protein | - |
| P8191_RS10160 (P8191_10160) | - | 1969725..1970543 (+) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| P8191_RS10165 (P8191_10165) | - | 1970597..1971013 (+) | 417 | WP_011888692.1 | hypothetical protein | - |
| P8191_RS10170 (P8191_10170) | - | 1971003..1971335 (+) | 333 | WP_011888693.1 | minor capsid protein | - |
| P8191_RS10175 (P8191_10175) | - | 1971335..1971691 (+) | 357 | WP_010922083.1 | minor capsid protein | - |
| P8191_RS10180 (P8191_10180) | - | 1971688..1972086 (+) | 399 | WP_011888694.1 | minor capsid protein | - |
| P8191_RS10185 (P8191_10185) | - | 1972086..1972547 (+) | 462 | WP_011018120.1 | hypothetical protein | - |
| P8191_RS10190 (P8191_10190) | - | 1972591..1973025 (+) | 435 | WP_011888695.1 | hypothetical protein | - |
| P8191_RS10195 (P8191_10195) | - | 1973029..1973610 (+) | 582 | WP_011888696.1 | bacteriophage Gp15 family protein | - |
| P8191_RS10200 (P8191_10200) | - | 1973600..1976860 (+) | 3261 | WP_029714384.1 | tape measure protein | - |
| P8191_RS10205 (P8191_10205) | - | 1976857..1977573 (+) | 717 | WP_011888697.1 | distal tail protein Dit | - |
| P8191_RS10210 (P8191_10210) | - | 1977570..1979714 (+) | 2145 | WP_278100865.1 | phage tail spike protein | - |
| P8191_RS10215 (P8191_10215) | hylP | 1979711..1980733 (+) | 1023 | WP_278100866.1 | hyaluronidase HylP | - |
| P8191_RS10220 (P8191_10220) | - | 1980746..1982632 (+) | 1887 | WP_014635603.1 | gp58-like family protein | - |
| P8191_RS10225 (P8191_10225) | - | 1982644..1983075 (+) | 432 | WP_002983467.1 | DUF1617 family protein | - |
| P8191_RS10230 (P8191_10230) | - | 1983078..1983710 (+) | 633 | WP_011888699.1 | hypothetical protein | - |
| P8191_RS10235 (P8191_10235) | - | 1983720..1984175 (+) | 456 | WP_011184730.1 | phage holin family protein | - |
| P8191_RS10240 (P8191_10240) | - | 1984177..1984299 (+) | 123 | WP_029713948.1 | hypothetical protein | - |
| P8191_RS10245 (P8191_10245) | - | 1984287..1985492 (+) | 1206 | WP_011888700.1 | glucosaminidase domain-containing protein | - |
| P8191_RS10250 (P8191_10250) | - | 1985632..1986156 (+) | 525 | WP_011017840.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| P8191_RS10255 (P8191_10255) | - | 1986144..1986452 (+) | 309 | WP_228549913.1 | hypothetical protein | - |
| P8191_RS10260 (P8191_10260) | - | 1986600..1987010 (+) | 411 | WP_228549912.1 | hypothetical protein | - |
| P8191_RS10265 (P8191_10265) | - | 1987060..1987494 (-) | 435 | WP_011017966.1 | hypothetical protein | - |
| P8191_RS10270 (P8191_10270) | sda3 | 1987767..1988567 (-) | 801 | WP_011285611.1 | streptodornase Sda3 | - |
| P8191_RS10275 (P8191_10275) | prx | 1988805..1988987 (+) | 183 | WP_011184907.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=811368 P8191_RS10065 WP_011285575.1 1957118..1957543(+) (ssb) [Streptococcus pyogenes strain 1044]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=811368 P8191_RS10065 WP_011285575.1 1957118..1957543(+) (ssb) [Streptococcus pyogenes strain 1044]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |