Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | P3K37_RS02855 | Genome accession | NZ_CP119695 |
| Coordinates | 642387..642824 (+) | Length | 145 a.a. |
| NCBI ID | WP_065354599.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain CUVET16-803 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 625420..675591 | 642387..642824 | within | 0 |
Gene organization within MGE regions
Location: 625420..675591
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3K37_RS02725 (P3K37_02645) | - | 625420..625998 (-) | 579 | WP_014613162.1 | CHAP domain-containing protein | - |
| P3K37_RS02730 (P3K37_02650) | - | 626669..627745 (+) | 1077 | WP_096533481.1 | NAD/NADP-dependent octopine/nopaline dehydrogenase family protein | - |
| P3K37_RS02735 (P3K37_02655) | nhaC | 627771..629168 (+) | 1398 | WP_037542391.1 | Na+/H+ antiporter NhaC | - |
| P3K37_RS02740 (P3K37_02660) | - | 629440..629916 (+) | 477 | WP_096533482.1 | hypothetical protein | - |
| P3K37_RS02745 (P3K37_02665) | - | 630080..630808 (-) | 729 | WP_015729537.1 | CHAP domain-containing protein | - |
| P3K37_RS02750 (P3K37_02670) | - | 631513..632565 (+) | 1053 | WP_096533483.1 | LLM class flavin-dependent oxidoreductase | - |
| P3K37_RS02755 (P3K37_02675) | - | 632579..632932 (+) | 354 | WP_096533484.1 | DoxX family protein | - |
| P3K37_RS02760 (P3K37_02680) | - | 633395..633742 (+) | 348 | WP_096533485.1 | transcriptional regulator, SarA/Rot family | - |
| P3K37_RS02765 (P3K37_02685) | - | 634181..635332 (+) | 1152 | WP_203152650.1 | acyl-CoA dehydrogenase family protein | - |
| P3K37_RS02770 (P3K37_02690) | - | 635361..636407 (-) | 1047 | WP_063282612.1 | tyrosine-type recombinase/integrase | - |
| P3K37_RS02775 (P3K37_02695) | - | 636468..636905 (-) | 438 | WP_096533921.1 | hypothetical protein | - |
| P3K37_RS02780 (P3K37_02700) | - | 636918..637085 (-) | 168 | WP_019165842.1 | hypothetical protein | - |
| P3K37_RS02785 (P3K37_02705) | - | 637097..637819 (-) | 723 | WP_390175658.1 | XRE family transcriptional regulator | - |
| P3K37_RS02790 (P3K37_02710) | - | 637971..638183 (+) | 213 | WP_063282614.1 | helix-turn-helix transcriptional regulator | - |
| P3K37_RS02795 (P3K37_02715) | - | 638229..638390 (+) | 162 | WP_037543668.1 | hypothetical protein | - |
| P3K37_RS02800 (P3K37_02720) | - | 638394..638657 (-) | 264 | WP_037543667.1 | CRISPR-associated endonuclease Cas2 | - |
| P3K37_RS02805 (P3K37_02725) | - | 638714..638908 (+) | 195 | WP_015728796.1 | hypothetical protein | - |
| P3K37_RS02810 (P3K37_02730) | - | 639014..639181 (+) | 168 | WP_015728797.1 | hypothetical protein | - |
| P3K37_RS02815 (P3K37_02735) | - | 639178..639405 (-) | 228 | WP_060830240.1 | hypothetical protein | - |
| P3K37_RS02820 (P3K37_02740) | - | 639483..640226 (+) | 744 | WP_060830239.1 | BRO family protein | - |
| P3K37_RS02825 (P3K37_02745) | - | 640223..640447 (+) | 225 | WP_015728800.1 | hypothetical protein | - |
| P3K37_RS02830 (P3K37_02750) | - | 640435..640623 (+) | 189 | WP_065354752.1 | hypothetical protein | - |
| P3K37_RS02835 (P3K37_02755) | - | 640693..640953 (+) | 261 | WP_404952266.1 | DUF1108 family protein | - |
| P3K37_RS02840 (P3K37_02760) | - | 640965..641219 (+) | 255 | WP_404952268.1 | hypothetical protein | - |
| P3K37_RS02845 (P3K37_02765) | - | 641212..641760 (+) | 549 | WP_404952270.1 | host-nuclease inhibitor Gam family protein | - |
| P3K37_RS02850 (P3K37_02770) | - | 641764..642387 (+) | 624 | WP_404952511.1 | ERF family protein | - |
| P3K37_RS02855 (P3K37_02775) | ssbA | 642387..642824 (+) | 438 | WP_065354599.1 | single-stranded DNA-binding protein | Machinery gene |
| P3K37_RS02860 (P3K37_02780) | - | 643008..643676 (+) | 669 | WP_404952271.1 | putative HNHc nuclease | - |
| P3K37_RS02865 (P3K37_02785) | - | 643692..644174 (-) | 483 | WP_316676361.1 | hypothetical protein | - |
| P3K37_RS02870 (P3K37_02790) | - | 644218..644955 (+) | 738 | WP_316676359.1 | conserved phage C-terminal domain-containing protein | - |
| P3K37_RS02875 (P3K37_02795) | - | 644958..645734 (+) | 777 | WP_100008597.1 | ATP-binding protein | - |
| P3K37_RS02880 (P3K37_02800) | - | 645728..645907 (+) | 180 | WP_404952274.1 | hypothetical protein | - |
| P3K37_RS02885 (P3K37_02805) | - | 645908..646342 (+) | 435 | WP_404952276.1 | RusA family crossover junction endodeoxyribonuclease | - |
| P3K37_RS02890 (P3K37_02810) | - | 646326..646544 (+) | 219 | WP_096533165.1 | hypothetical protein | - |
| P3K37_RS02895 (P3K37_02815) | - | 646557..646877 (+) | 321 | WP_189695464.1 | hypothetical protein | - |
| P3K37_RS02900 (P3K37_02820) | - | 647038..647490 (+) | 453 | WP_404952277.1 | hypothetical protein | - |
| P3K37_RS02905 (P3K37_02825) | - | 647511..648035 (+) | 525 | WP_110149719.1 | HNH endonuclease | - |
| P3K37_RS02910 (P3K37_02830) | - | 648054..648983 (+) | 930 | WP_404952513.1 | DNA cytosine methyltransferase | - |
| P3K37_RS02915 (P3K37_02835) | - | 649054..649230 (+) | 177 | WP_019169002.1 | hypothetical protein | - |
| P3K37_RS02920 (P3K37_02840) | - | 649230..649616 (+) | 387 | WP_404952280.1 | hypothetical protein | - |
| P3K37_RS02925 (P3K37_02845) | - | 649613..649915 (+) | 303 | WP_180895963.1 | hypothetical protein | - |
| P3K37_RS02930 (P3K37_02850) | - | 649916..650176 (+) | 261 | WP_037542743.1 | hypothetical protein | - |
| P3K37_RS02935 (P3K37_02855) | - | 650199..650465 (+) | 267 | WP_037543610.1 | hypothetical protein | - |
| P3K37_RS02940 (P3K37_02860) | - | 650467..650838 (+) | 372 | WP_096533174.1 | hypothetical protein | - |
| P3K37_RS02945 (P3K37_02865) | - | 650857..651387 (+) | 531 | WP_404952283.1 | dUTPase | - |
| P3K37_RS02950 (P3K37_02870) | - | 651460..651888 (+) | 429 | WP_096561739.1 | class I SAM-dependent methyltransferase | - |
| P3K37_RS02955 (P3K37_02875) | - | 651885..652073 (+) | 189 | WP_404952285.1 | DUF1381 domain-containing protein | - |
| P3K37_RS02960 (P3K37_02880) | rinB | 652070..652237 (+) | 168 | WP_404952287.1 | transcriptional activator RinB | - |
| P3K37_RS02965 (P3K37_02885) | - | 652237..652380 (+) | 144 | WP_154800885.1 | hypothetical protein | - |
| P3K37_RS02970 (P3K37_02890) | - | 652381..652806 (+) | 426 | WP_037543601.1 | sigma factor-like helix-turn-helix DNA-binding protein | - |
| P3K37_RS02975 (P3K37_02895) | - | 652992..653219 (+) | 228 | WP_096533880.1 | hypothetical protein | - |
| P3K37_RS02980 (P3K37_02900) | - | 653289..653783 (+) | 495 | WP_404952289.1 | terminase small subunit | - |
| P3K37_RS02985 (P3K37_02905) | - | 653785..655059 (+) | 1275 | WP_189695458.1 | PBSX family phage terminase large subunit | - |
| P3K37_RS02990 (P3K37_02910) | - | 655071..656516 (+) | 1446 | WP_214527091.1 | phage portal protein | - |
| P3K37_RS02995 (P3K37_02915) | - | 656509..657858 (+) | 1350 | WP_259488780.1 | minor capsid protein | - |
| P3K37_RS03000 (P3K37_02920) | - | 657858..658052 (+) | 195 | WP_037543592.1 | hypothetical protein | - |
| P3K37_RS03005 (P3K37_02925) | - | 658229..658840 (+) | 612 | WP_404952292.1 | DUF4355 domain-containing protein | - |
| P3K37_RS03010 (P3K37_02930) | - | 658858..659769 (+) | 912 | WP_103866916.1 | capsid protein | - |
| P3K37_RS03015 (P3K37_02935) | - | 659859..660308 (+) | 450 | WP_198462511.1 | Ig-like domain-containing protein | - |
| P3K37_RS03020 (P3K37_02940) | - | 660320..660652 (+) | 333 | WP_203163231.1 | phage head-tail connector protein | - |
| P3K37_RS03025 (P3K37_02945) | - | 660954..661304 (+) | 351 | WP_316644257.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| P3K37_RS03030 (P3K37_02950) | - | 661316..661711 (+) | 396 | WP_063282647.1 | hypothetical protein | - |
| P3K37_RS03035 (P3K37_02955) | - | 661729..662382 (+) | 654 | WP_103866912.1 | phage major tail protein, TP901-1 family | - |
| P3K37_RS03040 (P3K37_02960) | - | 662442..662822 (+) | 381 | WP_096533868.1 | tail assembly chaperone | - |
| P3K37_RS03045 (P3K37_02965) | - | 662852..663202 (+) | 351 | WP_096536435.1 | hypothetical protein | - |
| P3K37_RS03050 (P3K37_02970) | - | 663219..666338 (+) | 3120 | WP_203163228.1 | phage tail protein | - |
| P3K37_RS03055 (P3K37_02975) | - | 666351..667283 (+) | 933 | WP_203163227.1 | phage tail family protein | - |
| P3K37_RS03060 (P3K37_02980) | - | 667296..668693 (+) | 1398 | WP_203163226.1 | phage tail protein | - |
| P3K37_RS03065 (P3K37_02985) | - | 668697..669389 (+) | 693 | WP_203163225.1 | hypothetical protein | - |
| P3K37_RS03070 (P3K37_02990) | - | 669401..670444 (+) | 1044 | WP_203163224.1 | SGNH/GDSL hydrolase family protein | - |
| P3K37_RS03075 (P3K37_02995) | - | 670461..671732 (+) | 1272 | WP_203163223.1 | phage baseplate upper protein | - |
| P3K37_RS03080 (P3K37_03000) | - | 671765..672139 (+) | 375 | WP_015728845.1 | hypothetical protein | - |
| P3K37_RS03085 (P3K37_03005) | - | 672262..674151 (+) | 1890 | WP_316635263.1 | glucosaminidase domain-containing protein | - |
| P3K37_RS03090 (P3K37_03010) | - | 674171..674425 (+) | 255 | WP_015728847.1 | phage holin | - |
| P3K37_RS03095 (P3K37_03015) | - | 674438..675193 (+) | 756 | WP_316635265.1 | CHAP domain-containing protein | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 16466.13 Da Isoelectric Point: 4.9225
>NTDB_id=800479 P3K37_RS02855 WP_065354599.1 642387..642824(+) (ssbA) [Staphylococcus pseudintermedius strain CUVET16-803]
MLNRVVLVGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKNNNQSNNQPQQQRGQAPAQDNPFTNANNPIDIDDEDLPF
MLNRVVLVGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKNNNQSNNQPQQQRGQAPAQDNPFTNANNPIDIDDEDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=800479 P3K37_RS02855 WP_065354599.1 642387..642824(+) (ssbA) [Staphylococcus pseudintermedius strain CUVET16-803]
ATGCTCAACAGAGTCGTATTGGTAGGTCGATTAACAAAAGACCCGGAATTCAGAACAACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTAGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTTGCAGGTGTAGATGGCCGCTTACAATCACGC
AGTTATGAGAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAGCGTGCAATTTTTAGAGTCTAAAAA
TAACAATCAATCTAACAACCAACCACAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACGCAAATA
ATCCGATTGACATCGACGATGAAGATTTACCCTTTTGA
ATGCTCAACAGAGTCGTATTGGTAGGTCGATTAACAAAAGACCCGGAATTCAGAACAACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTAGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTTGCAGGTGTAGATGGCCGCTTACAATCACGC
AGTTATGAGAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAGCGTGCAATTTTTAGAGTCTAAAAA
TAACAATCAATCTAACAACCAACCACAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACGCAAATA
ATCCGATTGACATCGACGATGAAGATTTACCCTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.395 |
100 |
0.669 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.176 |
100 |
0.6 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
73.103 |
0.414 |
| ssbA | Streptococcus mutans UA159 |
38.621 |
100 |
0.386 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.931 |
100 |
0.379 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
37.931 |
100 |
0.379 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.931 |
100 |
0.379 |
| ssb | Glaesserella parasuis strain SC1401 |
30.337 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.241 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
30.636 |
100 |
0.366 |