Detailed information NTG0798021

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: PY824_RS00820
• Genome accession: NZ_CP119172
• Coordinates: 118627..118920 (+)
• Length: 97 a.a.
• NCBI ID: WP_039670352.1
• Uniprot ID: A0A380K2F0
• Organism: Streptococcus macedonicus strain SGM CIP105683
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 113627..123920

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PY824_RS00805 (PY824_00805)	-	116280..116609 (+)	330	WP_014293762.1	DUF1033 family protein	-
PY824_RS00810 (PY824_00810)	comYA	116719..117660 (+)	942	WP_014293763.1	competence type IV pilus ATPase ComGA	Machinery gene
PY824_RS00815 (PY824_00815)	comYB	117542..118627 (+)	1086	WP_014293764.1	competence type IV pilus assembly protein ComGB	Machinery gene
PY824_RS00820 (PY824_00820)	comYC	118627..118920 (+)	294	WP_039670352.1	competence type IV pilus major pilin ComGC	Machinery gene
PY824_RS00825 (PY824_00825)	comYD	118904..119335 (+)	432	WP_014293766.1	competence type IV pilus minor pilin ComGD	Machinery gene
PY824_RS00830 (PY824_00830)	comGE	119289..119582 (+)	294	WP_044562943.1	competence type IV pilus minor pilin ComGE	-
PY824_RS00835 (PY824_00835)	comYF	119536..120003 (+)	468	WP_014293768.1	competence type IV pilus minor pilin ComGF	Machinery gene
PY824_RS00840 (PY824_00840)	comYG	119975..120280 (+)	306	WP_014293769.1	competence type IV pilus minor pilin ComGG	Machinery gene
PY824_RS00845 (PY824_00845)	comYH	120362..121318 (+)	957	WP_014293770.1	class I SAM-dependent methyltransferase	Machinery gene
PY824_RS00850 (PY824_00850)	-	121371..122570 (+)	1200	WP_014293771.1	acetate kinase	-
PY824_RS00855 (PY824_00855)	-	122732..122932 (+)	201	WP_012961332.1	helix-turn-helix transcriptional regulator	-
PY824_RS00860 (PY824_00860)	-	122942..123151 (+)	210	WP_014293772.1	hypothetical protein	-
PY824_RS00865 (PY824_00865)	-	123164..123616 (+)	453	WP_014293773.1	hypothetical protein	-

Sequence

Protein

• Length: 97 a.a.
• Molecular weight: 11108.25 Da
• Isoelectric Point: 9.9310

>NTDB_id=798021 PY824_RS00820 WP_039670352.1 118627..118920(+) (comYC) [Streptococcus macedonicus strain SGM CIP105683]
MKKFWKKLRQKTVKGFTLVEMLIVLLIISVLMLLFVPNLSKQKDVVREKGDAAVVKVVESQMDLYEMKTGDKPTVDDLVE
VGYITSEQAKTYNEAKK

Nucleotide

• Length: 294 bp

>NTDB_id=798021 PY824_RS00820 WP_039670352.1 118627..118920(+) (comYC) [Streptococcus macedonicus strain SGM CIP105683]
ATGAAAAAGTTTTGGAAAAAATTACGTCAGAAAACGGTAAAAGGGTTCACACTTGTGGAGATGTTGATTGTGCTTCTTAT
TATCAGTGTTTTAATGTTGCTTTTTGTACCGAATTTGAGTAAGCAAAAGGATGTTGTTCGTGAAAAAGGCGATGCTGCTG
TTGTGAAAGTGGTAGAGAGCCAAATGGATTTGTACGAAATGAAAACGGGAGACAAACCGACTGTTGATGATTTAGTTGAA
GTTGGCTACATCACTTCTGAACAAGCAAAAACTTACAATGAAGCTAAAAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (13-34)

3D structure

• AlphaFold DB: A0A380K2F0

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	67.391	94.845	0.639
comYC	Streptococcus gordonii str. Challis substr. CH1	64.773	90.722	0.588
comGC/cglC	Streptococcus mitis SK321	60.638	96.907	0.588
comGC/cglC	Streptococcus pneumoniae D39	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae R6	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae TIGR4	59.574	96.907	0.577
comGC/cglC	Streptococcus pneumoniae Rx1	59.574	96.907	0.577
comGC/cglC	Streptococcus mitis NCTC 12261	59.574	96.907	0.577
comYC	Streptococcus mutans UA140	58.427	91.753	0.536
comYC	Streptococcus mutans UA159	58.427	91.753	0.536
comGC	Lactococcus lactis subsp. cremoris KW2	56.667	92.784	0.526
comGC	Staphylococcus aureus MW2	42.697	91.753	0.392
comGC	Staphylococcus aureus N315	42.697	91.753	0.392