NTDB

Overview

Name	pilA	Type	Machinery gene
Locus tag	RBH01_RS25200	Genome accession	NZ_CP132997
Coordinates	5393301..5393765 (-)	Length	154 a.a.
NCBI ID	WP_031630343.1	Uniprot ID	Q93PL5
Organism	Pseudomonas aeruginosa strain ZYPA162
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 5388301..5398765

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
RBH01_RS25180 (RBH01_25185)	ampD	5388992..5389558 (-)	567	WP_003104911.1	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	-
RBH01_RS25185 (RBH01_25190)	-	5389709..5391964 (-)	2256	WP_003104913.1	DUF1631 domain-containing protein	-
RBH01_RS25190 (RBH01_25195)	nadC	5392250..5393098 (+)	849	WP_096253229.1	carboxylating nicotinate-nucleotide diphosphorylase	-
RBH01_RS25200 (RBH01_25205)	pilA	5393301..5393765 (-)	465	WP_031630343.1	pilin	Machinery gene
RBH01_RS25205 (RBH01_25210)	pilB	5393995..5395695 (+)	1701	WP_096253228.1	type IV-A pilus assembly ATPase PilB	Machinery gene
RBH01_RS25210 (RBH01_25215)	pilC	5395699..5396916 (+)	1218	WP_003107299.1	type II secretion system F family protein	Machinery gene
RBH01_RS25215 (RBH01_25220)	pilD	5396917..5397789 (+)	873	WP_023084740.1	type IV prepilin peptidase/methyltransferase PilD	Machinery gene
RBH01_RS25220 (RBH01_25225)	coaE	5397786..5398397 (+)	612	WP_003112838.1	dephospho-CoA kinase	-
RBH01_RS25225 (RBH01_25230)	yacG	5398394..5398594 (+)	201	WP_003094656.1	DNA gyrase inhibitor YacG	-

Sequence

Protein

Download Length: 154 a.a. Molecular weight: 15780.91 Da Isoelectric Point: 6.1571

                                >NTDB_id=797957 RBH01_RS25200 WP_031630343.1 5393301..5393765(-) (pilA) [Pseudomonas aeruginosa strain ZYPA162]

MKAQKGFTLIELMIVVAIIGILAAIAIPQYQNYVSRSQVSRVMAEAGSLKTAVEACLQDGRTAVGTAAGQCDPGATGSSL

LTGASQTSQTLPTNTGVPQVLDPLTTQTTIIATFGNGASAAISGQTLTWTRDVNGGWSCATTVDAKFRPNGCTD

Nucleotide

Download Length: 465 bp

                                >NTDB_id=797957 RBH01_RS25200 WP_031630343.1 5393301..5393765(-) (pilA) [Pseudomonas aeruginosa strain ZYPA162]

ATGAAAGCACAGAAGGGTTTTACTCTGATTGAACTGATGATCGTAGTTGCGATCATTGGTATTCTGGCTGCAATCGCAAT

TCCCCAATATCAGAACTATGTTTCTCGCTCTCAGGTCTCCAGGGTTATGGCAGAGGCTGGCTCCTTGAAGACTGCAGTTG

AGGCCTGCCTCCAGGATGGTCGTACTGCTGTGGGTACTGCTGCTGGTCAATGCGACCCGGGTGCGACGGGTTCCAGTTTG

TTGACTGGTGCTTCTCAGACTTCTCAAACCCTGCCAACCAATACCGGTGTTCCGCAGGTTCTGGATCCTCTGACTACTCA

AACCACTATCATTGCGACTTTTGGTAACGGTGCATCCGCAGCTATTTCTGGCCAGACTCTGACCTGGACTCGTGATGTTA

ATGGTGGCTGGAGCTGTGCTACTACCGTAGATGCTAAATTCCGTCCTAATGGCTGTACTGACTGA

Domains

Predicted by InterProScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(1-26)

Pilin (bacterial filament) (Pilin)

(35-153)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	Q93PL5

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA	Pseudomonas aeruginosa PAK	46.753	100	0.468
pilA	Vibrio cholerae strain A1552	43.59	100	0.442
pilA	Vibrio cholerae C6706	43.59	100	0.442
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	43.59	100	0.442
comP	Acinetobacter baylyi ADP1	40.12	100	0.435
pilA	Vibrio parahaemolyticus RIMD 2210633	40.881	100	0.422
pilA	Acinetobacter baumannii strain A118	41.83	99.351	0.416
pilA2	Legionella pneumophila strain ERS1305867	41.558	100	0.416
pilA2	Legionella pneumophila str. Paris	40.909	100	0.409
pilA/pilAI	Pseudomonas stutzeri DSM 10701	40	100	0.403
pilE	Neisseria gonorrhoeae MS11	33.908	100	0.383
pilA/pilAII	Pseudomonas stutzeri DSM 10701	38.411	98.052	0.377

Detailed information NTG0797957