Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PWK65_RS05355 | Genome accession | NZ_CP118481 |
| Coordinates | 1041977..1042402 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 20185322 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1006712..1053028 | 1041977..1042402 | within | 0 |
Gene organization within MGE regions
Location: 1006712..1053028
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PWK65_RS05110 (PWK65_05055) | pfkA | 1006712..1007725 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| PWK65_RS05115 (PWK65_05060) | - | 1007805..1010915 (-) | 3111 | WP_002989620.1 | DNA polymerase III subunit alpha | - |
| PWK65_RS05120 (PWK65_05065) | - | 1011100..1011471 (+) | 372 | WP_002989617.1 | GntR family transcriptional regulator | - |
| PWK65_RS05125 (PWK65_05070) | - | 1011471..1012169 (+) | 699 | WP_002989613.1 | ABC transporter ATP-binding protein | - |
| PWK65_RS05130 (PWK65_05075) | - | 1012179..1012964 (+) | 786 | WP_002989610.1 | hypothetical protein | - |
| PWK65_RS05135 (PWK65_05080) | - | 1013097..1013711 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| PWK65_RS05145 (PWK65_05090) | prx | 1014302..1014490 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| PWK65_RS05150 (PWK65_05095) | speA | 1014710..1015465 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| PWK65_RS05155 (PWK65_05100) | - | 1015587..1016246 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| PWK65_RS05160 (PWK65_05105) | - | 1016246..1016467 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| PWK65_RS05165 (PWK65_05110) | - | 1016477..1017250 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| PWK65_RS05170 (PWK65_05115) | - | 1017261..1017863 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| PWK65_RS05175 (PWK65_05120) | - | 1017875..1018639 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| PWK65_RS05180 (PWK65_05125) | - | 1018641..1018973 (-) | 333 | WP_011285562.1 | phage holin | - |
| PWK65_RS05185 (PWK65_05130) | - | 1018973..1019296 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| PWK65_RS05190 (PWK65_05135) | - | 1019310..1019432 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| PWK65_RS05195 (PWK65_05140) | - | 1019446..1019793 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| PWK65_RS05200 (PWK65_05145) | - | 1019804..1021666 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| PWK65_RS05205 (PWK65_05150) | - | 1021671..1025111 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| PWK65_RS05210 (PWK65_05155) | - | 1025112..1026596 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| PWK65_RS05215 (PWK65_05160) | - | 1026597..1028402 (-) | 1806 | WP_011054802.1 | tail protein | - |
| PWK65_RS05220 (PWK65_05165) | - | 1028395..1028853 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| PWK65_RS05225 (PWK65_05170) | - | 1028826..1029143 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| PWK65_RS05230 (PWK65_05175) | - | 1029156..1029662 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| PWK65_RS05235 (PWK65_05180) | - | 1029674..1030084 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| PWK65_RS05240 (PWK65_05185) | - | 1030086..1030481 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| PWK65_RS05245 (PWK65_05190) | - | 1030478..1030789 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| PWK65_RS05250 (PWK65_05195) | - | 1030786..1031130 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| PWK65_RS05255 (PWK65_05200) | - | 1031144..1031437 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| PWK65_RS05260 (PWK65_05205) | - | 1031450..1032340 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| PWK65_RS05265 (PWK65_05210) | - | 1032359..1032928 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| PWK65_RS05270 (PWK65_05215) | - | 1033037..1033171 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| PWK65_RS05275 (PWK65_05220) | - | 1033173..1033442 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| PWK65_RS05280 (PWK65_05225) | - | 1033449..1034357 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| PWK65_RS05285 (PWK65_05230) | - | 1034326..1035651 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| PWK65_RS05290 (PWK65_05235) | - | 1035651..1036925 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| PWK65_RS05295 (PWK65_05240) | - | 1036915..1037295 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| PWK65_RS05300 (PWK65_05245) | - | 1037905..1038339 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| PWK65_RS05305 (PWK65_05250) | - | 1038625..1038891 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| PWK65_RS05310 (PWK65_05255) | - | 1038888..1039412 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| PWK65_RS05315 (PWK65_05260) | - | 1039415..1040047 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| PWK65_RS05320 (PWK65_05265) | - | 1040049..1040333 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| PWK65_RS05325 (PWK65_05270) | - | 1040330..1040500 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| PWK65_RS05330 (PWK65_05275) | - | 1040497..1040733 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| PWK65_RS05335 | - | 1040733..1040978 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| PWK65_RS05340 (PWK65_05280) | - | 1040975..1041331 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| PWK65_RS05345 (PWK65_05285) | - | 1041328..1041768 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PWK65_RS05350 (PWK65_05290) | - | 1041768..1041971 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| PWK65_RS05355 (PWK65_05295) | ssb | 1041977..1042402 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| PWK65_RS05360 (PWK65_05300) | - | 1042395..1043069 (-) | 675 | WP_397610604.1 | ERF family protein | - |
| PWK65_RS05365 (PWK65_05305) | - | 1043070..1043552 (-) | 483 | WP_011285577.1 | siphovirus Gp157 family protein | - |
| PWK65_RS05370 (PWK65_05310) | - | 1043574..1043828 (-) | 255 | WP_011285578.1 | hypothetical protein | - |
| PWK65_RS05375 (PWK65_05315) | - | 1043809..1044162 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| PWK65_RS05380 (PWK65_05320) | - | 1044303..1045085 (-) | 783 | WP_011285581.1 | ATP-binding protein | - |
| PWK65_RS05385 (PWK65_05325) | - | 1045072..1045902 (-) | 831 | WP_009881060.1 | phage replisome organizer N-terminal domain-containing protein | - |
| PWK65_RS05390 (PWK65_05330) | - | 1045916..1046104 (-) | 189 | Protein_1015 | XRE family transcriptional regulator | - |
| PWK65_RS05395 (PWK65_05335) | - | 1046209..1046577 (+) | 369 | WP_015055958.1 | hypothetical protein | - |
| PWK65_RS05400 (PWK65_05340) | - | 1046708..1046917 (+) | 210 | WP_011017885.1 | hypothetical protein | - |
| PWK65_RS05405 (PWK65_05345) | - | 1047027..1047227 (-) | 201 | WP_002992770.1 | helix-turn-helix domain-containing protein | - |
| PWK65_RS05410 (PWK65_05350) | - | 1047301..1047687 (+) | 387 | WP_011054589.1 | hypothetical protein | - |
| PWK65_RS05415 (PWK65_05355) | - | 1047676..1047885 (-) | 210 | WP_011284881.1 | hypothetical protein | - |
| PWK65_RS05420 (PWK65_05360) | - | 1047939..1048538 (+) | 600 | WP_011284882.1 | hypothetical protein | - |
| PWK65_RS05425 (PWK65_05365) | - | 1048568..1048726 (-) | 159 | WP_011285583.1 | hypothetical protein | - |
| PWK65_RS05430 (PWK65_05370) | - | 1049083..1049907 (+) | 825 | WP_011285584.1 | helix-turn-helix transcriptional regulator | - |
| PWK65_RS05435 (PWK65_05375) | - | 1049943..1050836 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| PWK65_RS05440 (PWK65_05380) | - | 1050957..1052045 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| PWK65_RS05445 (PWK65_05385) | - | 1052408..1053028 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=792673 PWK65_RS05355 WP_011285575.1 1041977..1042402(-) (ssb) [Streptococcus pyogenes strain 20185322]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=792673 PWK65_RS05355 WP_011285575.1 1041977..1042402(-) (ssb) [Streptococcus pyogenes strain 20185322]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |