Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | PVK48_RS05600 | Genome accession | NZ_CP118307 |
| Coordinates | 1082969..1083394 (-) | Length | 141 a.a. |
| NCBI ID | WP_011285575.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain 20200554 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1047704..1096173 | 1082969..1083394 | within | 0 |
Gene organization within MGE regions
Location: 1047704..1096173
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PVK48_RS05355 (PVK48_05305) | pfkA | 1047704..1048717 (-) | 1014 | WP_002984444.1 | 6-phosphofructokinase | - |
| PVK48_RS05360 (PVK48_05310) | - | 1048797..1051907 (-) | 3111 | WP_011527661.1 | DNA polymerase III subunit alpha | - |
| PVK48_RS05365 (PVK48_05315) | - | 1052092..1052463 (+) | 372 | WP_346393437.1 | GntR family transcriptional regulator | - |
| PVK48_RS05370 (PVK48_05320) | - | 1052463..1053161 (+) | 699 | WP_002984437.1 | ABC transporter ATP-binding protein | - |
| PVK48_RS05375 (PVK48_05325) | - | 1053171..1053956 (+) | 786 | WP_002989610.1 | hypothetical protein | - |
| PVK48_RS05380 (PVK48_05330) | - | 1054089..1054703 (-) | 615 | WP_002989607.1 | TVP38/TMEM64 family protein | - |
| PVK48_RS05390 (PVK48_05340) | prx | 1055294..1055482 (-) | 189 | WP_011285559.1 | hypothetical protein | Regulator |
| PVK48_RS05395 (PVK48_05345) | speA | 1055702..1056457 (+) | 756 | WP_011285560.1 | streptococcal pyrogenic exotoxin SpeA | - |
| PVK48_RS05400 (PVK48_05350) | - | 1056579..1057238 (-) | 660 | WP_009880240.1 | hypothetical protein | - |
| PVK48_RS05405 (PVK48_05355) | - | 1057238..1057459 (-) | 222 | WP_009880241.1 | hypothetical protein | - |
| PVK48_RS05410 (PVK48_05360) | - | 1057469..1058242 (-) | 774 | WP_011054795.1 | hypothetical protein | - |
| PVK48_RS05415 (PVK48_05365) | - | 1058253..1058855 (-) | 603 | WP_011054796.1 | hypothetical protein | - |
| PVK48_RS05420 (PVK48_05370) | - | 1058867..1059631 (-) | 765 | WP_011285561.1 | CHAP domain-containing protein | - |
| PVK48_RS05425 (PVK48_05375) | - | 1059633..1059965 (-) | 333 | WP_011285562.1 | phage holin | - |
| PVK48_RS05430 (PVK48_05380) | - | 1059965..1060288 (-) | 324 | WP_015055952.1 | hypothetical protein | - |
| PVK48_RS05435 (PVK48_05385) | - | 1060302..1060424 (-) | 123 | WP_015055953.1 | hypothetical protein | - |
| PVK48_RS05440 (PVK48_05390) | - | 1060438..1060785 (-) | 348 | WP_011285564.1 | DUF1366 domain-containing protein | - |
| PVK48_RS05445 (PVK48_05395) | - | 1060796..1062658 (-) | 1863 | WP_015055954.1 | DUF859 family phage minor structural protein | - |
| PVK48_RS05450 (PVK48_05400) | - | 1062663..1066103 (-) | 3441 | WP_011285566.1 | glucosaminidase domain-containing protein | - |
| PVK48_RS05455 (PVK48_05405) | - | 1066104..1067588 (-) | 1485 | WP_009880250.1 | distal tail protein Dit | - |
| PVK48_RS05460 (PVK48_05410) | - | 1067589..1069394 (-) | 1806 | WP_011054802.1 | tail protein | - |
| PVK48_RS05465 (PVK48_05415) | - | 1069387..1069845 (-) | 459 | WP_009880253.1 | hypothetical protein | - |
| PVK48_RS05470 (PVK48_05420) | - | 1069818..1070135 (-) | 318 | WP_009880254.1 | hypothetical protein | - |
| PVK48_RS05475 (PVK48_05425) | - | 1070148..1070654 (-) | 507 | WP_009880255.1 | phage major tail protein, TP901-1 family | - |
| PVK48_RS05480 (PVK48_05430) | - | 1070666..1071076 (-) | 411 | WP_009880256.1 | DUF5072 family protein | - |
| PVK48_RS05485 (PVK48_05435) | - | 1071078..1071473 (-) | 396 | WP_009880257.1 | hypothetical protein | - |
| PVK48_RS05490 (PVK48_05440) | - | 1071470..1071781 (-) | 312 | WP_011285567.1 | hypothetical protein | - |
| PVK48_RS05495 (PVK48_05445) | - | 1071778..1072122 (-) | 345 | WP_009880259.1 | hypothetical protein | - |
| PVK48_RS05500 (PVK48_05450) | - | 1072136..1072429 (-) | 294 | WP_009880260.1 | HeH/LEM domain-containing protein | - |
| PVK48_RS05505 (PVK48_05455) | - | 1072442..1073332 (-) | 891 | WP_009880261.1 | hypothetical protein | - |
| PVK48_RS05510 (PVK48_05460) | - | 1073351..1073920 (-) | 570 | WP_009880262.1 | DUF4355 domain-containing protein | - |
| PVK48_RS05515 (PVK48_05465) | - | 1074029..1074163 (-) | 135 | WP_015055956.1 | hypothetical protein | - |
| PVK48_RS05520 (PVK48_05470) | - | 1074165..1074434 (-) | 270 | WP_011285568.1 | hypothetical protein | - |
| PVK48_RS05525 (PVK48_05475) | - | 1074441..1075349 (-) | 909 | WP_011285569.1 | minor capsid protein | - |
| PVK48_RS05530 (PVK48_05480) | - | 1075318..1076643 (-) | 1326 | WP_011285570.1 | phage portal protein | - |
| PVK48_RS05535 (PVK48_05485) | - | 1076643..1077917 (-) | 1275 | WP_009880266.1 | PBSX family phage terminase large subunit | - |
| PVK48_RS05540 (PVK48_05490) | - | 1077907..1078287 (-) | 381 | WP_011285571.1 | hypothetical protein | - |
| PVK48_RS05545 (PVK48_05495) | - | 1078897..1079331 (-) | 435 | WP_011054810.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| PVK48_RS05550 (PVK48_05500) | - | 1079617..1079883 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| PVK48_RS05555 (PVK48_05505) | - | 1079880..1080404 (-) | 525 | WP_011285572.1 | DUF1642 domain-containing protein | - |
| PVK48_RS05560 (PVK48_05510) | - | 1080407..1081039 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| PVK48_RS05565 (PVK48_05515) | - | 1081041..1081325 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| PVK48_RS05570 (PVK48_05520) | - | 1081322..1081492 (-) | 171 | WP_002995952.1 | hypothetical protein | - |
| PVK48_RS05575 (PVK48_05525) | - | 1081489..1081725 (-) | 237 | WP_002995955.1 | DUF3310 domain-containing protein | - |
| PVK48_RS05580 | - | 1081725..1081970 (-) | 246 | WP_011285573.1 | hypothetical protein | - |
| PVK48_RS05585 (PVK48_05530) | - | 1081967..1082323 (-) | 357 | WP_011284873.1 | hypothetical protein | - |
| PVK48_RS05590 (PVK48_05535) | - | 1082320..1082760 (-) | 441 | WP_011285574.1 | RusA family crossover junction endodeoxyribonuclease | - |
| PVK48_RS05595 (PVK48_05540) | - | 1082760..1082963 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| PVK48_RS05600 (PVK48_05545) | ssb | 1082969..1083394 (-) | 426 | WP_011285575.1 | single-stranded DNA-binding protein | Machinery gene |
| PVK48_RS05605 (PVK48_05550) | - | 1083387..1084061 (-) | 675 | WP_397610662.1 | ERF family protein | - |
| PVK48_RS05610 (PVK48_05555) | - | 1084062..1084544 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| PVK48_RS05615 (PVK48_05560) | - | 1084566..1084820 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| PVK48_RS05620 (PVK48_05565) | - | 1084801..1085154 (-) | 354 | WP_011285579.1 | hypothetical protein | - |
| PVK48_RS05625 (PVK48_05570) | - | 1085295..1086077 (-) | 783 | WP_021340659.1 | ATP-binding protein | - |
| PVK48_RS05630 (PVK48_05575) | - | 1086064..1086867 (-) | 804 | WP_021340639.1 | DnaD domain protein | - |
| PVK48_RS05635 (PVK48_05580) | - | 1086983..1087426 (-) | 444 | WP_012560973.1 | hypothetical protein | - |
| PVK48_RS05640 (PVK48_05585) | - | 1087482..1087862 (+) | 381 | WP_000568478.1 | hypothetical protein | - |
| PVK48_RS05645 (PVK48_05590) | - | 1087852..1088124 (-) | 273 | WP_000370473.1 | hypothetical protein | - |
| PVK48_RS05650 (PVK48_05595) | - | 1088297..1088476 (-) | 180 | WP_012560974.1 | hypothetical protein | - |
| PVK48_RS05655 (PVK48_05600) | - | 1088604..1088744 (-) | 141 | WP_021340647.1 | hypothetical protein | - |
| PVK48_RS05660 (PVK48_05605) | - | 1088774..1089031 (-) | 258 | WP_001191791.1 | hypothetical protein | - |
| PVK48_RS05665 (PVK48_05610) | - | 1089109..1089294 (-) | 186 | WP_021340658.1 | helix-turn-helix domain-containing protein | - |
| PVK48_RS05670 (PVK48_05615) | - | 1089438..1089659 (+) | 222 | WP_002992762.1 | hypothetical protein | - |
| PVK48_RS05675 (PVK48_05620) | - | 1089617..1089958 (-) | 342 | WP_021340657.1 | hypothetical protein | - |
| PVK48_RS05680 (PVK48_05625) | - | 1089977..1090183 (-) | 207 | WP_021733331.1 | hypothetical protein | - |
| PVK48_RS05685 (PVK48_05630) | - | 1090331..1090546 (-) | 216 | WP_000164463.1 | helix-turn-helix transcriptional regulator | - |
| PVK48_RS05690 (PVK48_05635) | - | 1090639..1091280 (+) | 642 | WP_001008979.1 | hypothetical protein | - |
| PVK48_RS05695 (PVK48_05640) | - | 1091379..1091537 (-) | 159 | WP_021340638.1 | hypothetical protein | - |
| PVK48_RS05700 (PVK48_05645) | - | 1091596..1091811 (+) | 216 | WP_014635530.1 | hypothetical protein | - |
| PVK48_RS05705 (PVK48_05650) | - | 1091797..1091946 (-) | 150 | WP_021340643.1 | hypothetical protein | - |
| PVK48_RS05710 (PVK48_05655) | - | 1092306..1093052 (+) | 747 | WP_397610663.1 | helix-turn-helix transcriptional regulator | - |
| PVK48_RS05715 (PVK48_05660) | - | 1093088..1093981 (+) | 894 | WP_011285585.1 | P63C domain-containing protein | - |
| PVK48_RS05720 (PVK48_05665) | - | 1094102..1095190 (+) | 1089 | WP_011054595.1 | site-specific integrase | - |
| PVK48_RS05725 (PVK48_05670) | - | 1095553..1096173 (+) | 621 | WP_002989605.1 | DUF3862 domain-containing protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15995.63 Da Isoelectric Point: 4.5748
>NTDB_id=791531 PVK48_RS05600 WP_011285575.1 1082969..1083394(-) (ssb) [Streptococcus pyogenes strain 20200554]
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
MINNIVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQEQRVYVTEVVAESFQMLESRNSQQQSGQDNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=791531 PVK48_RS05600 WP_011285575.1 1082969..1083394(-) (ssb) [Streptococcus pyogenes strain 20200554]
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
ATGATTAACAACATTGTGCTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGAACAACGTGTCTATGTGACGGAAGTTGTTGCAGAGAGTTTCCAAATGTTGGAAAGTCGAAA
TAGCCAGCAACAATCTGGTCAAGATAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATA
TTTCAGACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.07 |
100 |
0.66 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.262 |
100 |
0.433 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.262 |
100 |
0.433 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
79.433 |
0.411 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssb | Glaesserella parasuis strain SC1401 |
29.379 |
100 |
0.369 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.524 |
74.468 |
0.369 |