NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	Q3V86_RS07510	Genome accession	NZ_CP130547
Coordinates	1565492..1565803 (-)	Length	103 a.a.
NCBI ID	WP_000472256.1	Uniprot ID	A0A0H2XGS7
Organism	Staphylococcus aureus strain SA04-SX
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1560492..1570803

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
Q3V86_RS07475	gcvPA	1560994..1562340 (-)	1347	WP_000019698.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
Q3V86_RS07480	gcvT	1562360..1563451 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
Q3V86_RS07485	-	1563610..1564134 (-)	525	WP_001015120.1	shikimate kinase	-
Q3V86_RS07490	-	1564124..1564270 (-)	147	WP_001789879.1	hypothetical protein	-
Q3V86_RS07495	comGF	1564367..1564864 (-)	498	WP_001825340.1	competence type IV pilus minor pilin ComGF	Machinery gene
Q3V86_RS07500	comGE	1564782..1565081 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
Q3V86_RS07505	comGD	1565068..1565514 (-)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
Q3V86_RS07510	comGC	1565492..1565803 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
Q3V86_RS07515	comGB	1565817..1566887 (-)	1071	Protein_1477	competence type IV pilus assembly protein ComGB	-
Q3V86_RS07520	comGA	1566859..1567833 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
Q3V86_RS07525	-	1567885..1568508 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
Q3V86_RS07530	-	1568505..1568834 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
Q3V86_RS07535	-	1568834..1569820 (-)	987	WP_000161315.1	ROK family glucokinase	-
Q3V86_RS07540	-	1569817..1570020 (-)	204	WP_000087559.1	YqgQ family protein	-

Sequence

Protein

Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268

                                >NTDB_id=785478 Q3V86_RS07510 WP_000472256.1 1565492..1565803(-) (comGC) [Staphylococcus aureus strain SA04-SX]

MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI

KEAQKTCKSGETITISNGEAVAN

Nucleotide

Download Length: 312 bp

                                >NTDB_id=785478 Q3V86_RS07510 WP_000472256.1 1565492..1565803(-) (comGC) [Staphylococcus aureus strain SA04-SX]

ATGTTTAAATTTCTAAAAAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTATTATTAATCATCAGTTTATTATT

AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA

ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA

AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterProScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(6-30)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A0H2XGS7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comGC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comGC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369

Detailed information NTG0785478