Detailed information NTG0782217

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: PO908_RS01260
• Genome accession: NZ_CP117042
• Coordinates: 227348..227665 (+)
• Length: 105 a.a.
• NCBI ID: WP_003028473.1
• Uniprot ID: A0A0P0N5S2
• Organism: Streptococcus anginosus strain CGMH_KH1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 222348..232665

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PO908_RS01230 (PO908_01230)	-	222471..223001 (+)	531	WP_003032280.1	aromatic acid exporter family protein	-
PO908_RS01235 (PO908_01235)	-	223078..223437 (+)	360	WP_003028467.1	MerR family transcriptional regulator	-
PO908_RS01240 (PO908_01240)	glnA	223476..224822 (+)	1347	WP_003027006.1	type I glutamate--ammonia ligase	-
PO908_RS01245 (PO908_01245)	-	225011..225376 (+)	366	WP_003027003.1	DUF1033 family protein	-
PO908_RS01250 (PO908_01250)	comYA	225446..226387 (+)	942	WP_394468008.1	competence type IV pilus ATPase ComGA	Machinery gene
PO908_RS01255 (PO908_01255)	comYB	226329..227351 (+)	1023	WP_041783985.1	competence type IV pilus assembly protein ComGB	Machinery gene
PO908_RS01260 (PO908_01260)	comYC	227348..227665 (+)	318	WP_003028473.1	competence type IV pilus major pilin ComGC	Machinery gene
PO908_RS01265 (PO908_01265)	comYD	227625..228053 (+)	429	WP_021001232.1	competence type IV pilus minor pilin ComGD	Machinery gene
PO908_RS01270 (PO908_01270)	comGE/cglE	228025..228318 (+)	294	WP_021001233.1	competence type IV pilus minor pilin ComGE	Machinery gene
PO908_RS01275 (PO908_01275)	comGF/cglF	228302..228739 (+)	438	WP_041783987.1	competence type IV pilus minor pilin ComGF	Machinery gene
PO908_RS01280 (PO908_01280)	comGG	228720..229046 (+)	327	WP_021001234.1	competence type IV pilus minor pilin ComGG	-
PO908_RS01285 (PO908_01285)	comYH	229118..230071 (+)	954	WP_021001235.1	class I SAM-dependent methyltransferase	Machinery gene
PO908_RS01290 (PO908_01290)	-	230118..231317 (+)	1200	WP_021001236.1	acetate kinase	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11622.72 Da
• Isoelectric Point: 10.1006

>NTDB_id=782217 PO908_RS01260 WP_003028473.1 227348..227665(+) (comYC) [Streptococcus anginosus strain CGMH_KH1]
MKKLKSLKVKGFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVNEGT
ITDKQAASYKAYYAKHTKEARSVAD

Nucleotide

• Length: 318 bp

>NTDB_id=782217 PO908_RS01260 WP_003028473.1 227348..227665(+) (comYC) [Streptococcus anginosus strain CGMH_KH1]
ATGAAAAAATTAAAAAGTTTGAAGGTTAAAGGTTTTACTTTAGTAGAAATGTTAGTCGTACTTCTTATCATCAGTGTTTT
GATGCTCTTATTTGTACCGAATTTGACCAAGCAAAAAGAAGCTGTAACGGAAAAAGGAAATGCAGCGGTGGTAAAAGTTG
TGGAAAGCCAAGCGGAGCTGTTTGAGGTCAATCACACCAATGAAAAAGCGACACTCTCAAAATTAGTCAACGAAGGCACG
ATTACAGACAAGCAGGCAGCATCTTATAAGGCTTACTATGCGAAACATACAAAAGAAGCTCGTTCTGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

3D structure

• AlphaFold DB: A0A0P0N5S2

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	73.333	100	0.733
comYC	Streptococcus mutans UA159	66.667	100	0.667
comYC	Streptococcus mutans UA140	66.667	100	0.667
comGC/cglC	Streptococcus mitis NCTC 12261	68.627	97.143	0.667
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comYC	Streptococcus suis isolate S10	66.292	84.762	0.562
comGC	Lactococcus lactis subsp. cremoris KW2	54.808	99.048	0.543