NTDB

Overview

Name	pilA	Type	Machinery gene
Locus tag	PCP80_RS01275	Genome accession	NZ_CP115280
Coordinates	281002..281451 (-)	Length	149 a.a.
NCBI ID	WP_021264133.1	Uniprot ID	A0A509JKL4
Organism	Pseudomonas aeruginosa strain F010
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 276002..286451

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PCP80_RS01255 (PCP80_01255)	ampD	276694..277260 (-)	567	WP_003104911.1	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	-
PCP80_RS01260 (PCP80_01260)	-	277411..279666 (-)	2256	WP_016264271.1	DUF1631 domain-containing protein	-
PCP80_RS01265 (PCP80_01265)	nadC	279952..280800 (+)	849	WP_021264134.1	carboxylating nicotinate-nucleotide diphosphorylase	-
PCP80_RS01275 (PCP80_01275)	pilA	281002..281451 (-)	450	WP_021264133.1	pilin	Machinery gene
PCP80_RS01280 (PCP80_01280)	pilB	281683..283383 (+)	1701	WP_021264132.1	type IV-A pilus assembly ATPase PilB	Machinery gene
PCP80_RS01285 (PCP80_01285)	pilC	283387..284607 (+)	1221	WP_023101565.1	type 4a pilus biogenesis protein PilC	Machinery gene
PCP80_RS01290 (PCP80_01290)	pilD	284611..285483 (+)	873	WP_021264129.1	type IV prepilin peptidase/methyltransferase PilD	Machinery gene
PCP80_RS01295 (PCP80_01295)	coaE	285480..286091 (+)	612	WP_003094654.1	dephospho-CoA kinase	-
PCP80_RS01300 (PCP80_01300)	yacG	286088..286288 (+)	201	WP_003094656.1	DNA gyrase inhibitor YacG	-

Sequence

Protein

Download Length: 149 a.a. Molecular weight: 15537.82 Da Isoelectric Point: 7.7818

                                >NTDB_id=771190 PCP80_RS01275 WP_021264133.1 281002..281451(-) (pilA) [Pseudomonas aeruginosa strain F010]

MKAQKGFTLIELMIVVAIIGILAAIAIPQYQNYVARSEGASALATINPLKTTVEESLSRGIAGTNIKIGTDPSTATETYV

GVAANANKLGLIDVKIADTGAGDITFTFQTGTSSPKNATKVITLNRTADGVWACKSTQDPMFTPKGCDN

Nucleotide

Download Length: 450 bp

                                >NTDB_id=771190 PCP80_RS01275 WP_021264133.1 281002..281451(-) (pilA) [Pseudomonas aeruginosa strain F010]

ATGAAAGCTCAAAAAGGCTTTACTTTGATCGAACTGATGATCGTGGTTGCGATCATCGGTATCCTGGCGGCGATTGCCAT

TCCCCAGTACCAGAACTATGTGGCGCGTTCGGAAGGTGCTTCGGCGCTGGCGACGATCAATCCGCTGAAGACCACTGTTG

AAGAGTCTCTGTCGCGTGGAATTGCTGGTACCAATATTAAAATTGGTACTGATCCATCTACTGCCACCGAAACATATGTT

GGGGTTGCTGCGAATGCCAACAAGCTGGGCTTGATTGATGTAAAGATTGCTGATACTGGTGCGGGTGATATTACCTTTAC

CTTCCAGACTGGTACTTCTAGTCCCAAGAATGCTACTAAAGTTATCACTCTGAATCGTACTGCGGATGGGGTCTGGGCTT

GTAAATCTACCCAGGATCCGATGTTCACTCCGAAAGGTTGTGATAACTAA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(35-147)

Prokaryotic N-terminal methylation motif (N_methyl)

(1-26)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A509JKL4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA	Pseudomonas aeruginosa PAK	68.667	100	0.691
pilA/pilAI	Pseudomonas stutzeri DSM 10701	46.358	100	0.47
pilA	Acinetobacter baumannii strain A118	47.297	99.329	0.47
comP	Acinetobacter baylyi ADP1	43.59	100	0.456
pilA	Vibrio cholerae C6706	42.949	100	0.45
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	42.949	100	0.45
pilA	Vibrio cholerae strain A1552	42.949	100	0.45
pilA	Vibrio parahaemolyticus RIMD 2210633	45.578	98.658	0.45
pilA/pilAII	Pseudomonas stutzeri DSM 10701	45.455	95.973	0.436
pilA	Acinetobacter nosocomialis M2	41.429	93.96	0.389
pilA2	Legionella pneumophila str. Paris	39.189	99.329	0.389
pilA2	Legionella pneumophila strain ERS1305867	38.514	99.329	0.383

Detailed information NTG0771190