NTDB

Overview

Name	pilA	Type	Machinery gene
Locus tag	PCP08_RS19890	Genome accession	NZ_CP115234
Coordinates	4274064..4274516 (-)	Length	150 a.a.
NCBI ID	WP_024928732.1	Uniprot ID	-
Organism	Pseudomonas aeruginosa strain F048
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 4269064..4279516

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PCP08_RS19870 (PCP08_19855)	ampD	4269781..4270347 (-)	567	WP_003116245.1	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	-
PCP08_RS19875 (PCP08_19860)	-	4270498..4272753 (-)	2256	WP_003104913.1	DUF1631 domain-containing protein	-
PCP08_RS19880 (PCP08_19865)	nadC	4273039..4273887 (+)	849	WP_003161760.1	carboxylating nicotinate-nucleotide diphosphorylase	-
PCP08_RS19890 (PCP08_19875)	pilA	4274064..4274516 (-)	453	WP_024928732.1	pilin	Machinery gene
PCP08_RS19895 (PCP08_19880)	pilB	4274748..4276448 (+)	1701	WP_010793793.1	type IV-A pilus assembly ATPase PilB	Machinery gene
PCP08_RS19900 (PCP08_19885)	pilC	4276452..4277672 (+)	1221	WP_009315898.1	type 4a pilus biogenesis protein PilC	Machinery gene
PCP08_RS19905 (PCP08_19890)	pilD	4277676..4278548 (+)	873	WP_003125204.1	type IV prepilin peptidase/methyltransferase PilD	Machinery gene
PCP08_RS19910 (PCP08_19895)	coaE	4278545..4279156 (+)	612	WP_010793792.1	dephospho-CoA kinase	-
PCP08_RS19915 (PCP08_19900)	yacG	4279153..4279353 (+)	201	WP_003094656.1	DNA gyrase inhibitor YacG	-

Sequence

Protein

Download Length: 150 a.a. Molecular weight: 15413.63 Da Isoelectric Point: 8.4829

                                >NTDB_id=769907 PCP08_RS19890 WP_024928732.1 4274064..4274516(-) (pilA) [Pseudomonas aeruginosa strain F048]

MKAQKGFTLIELMIVVAIIGILAAIAIPQYQNYVARSEGASALATINPLKTTVEESLSRGIAGENIKIGSQASTADTTYV

GVDATANKLGTIAVTIGNNGAGTVTFTFAAGNSSPKNSGKIITLTRTDAGSWACTSTQDEMFIPKGCKAP

Nucleotide

Download Length: 453 bp

                                >NTDB_id=769907 PCP08_RS19890 WP_024928732.1 4274064..4274516(-) (pilA) [Pseudomonas aeruginosa strain F048]

ATGAAAGCTCAAAAAGGCTTTACCTTGATCGAACTGATGATCGTGGTTGCGATCATCGGTATCCTGGCGGCGATTGCCAT

TCCCCAGTACCAGAACTATGTGGCGCGTTCGGAAGGTGCTTCGGCGCTGGCGACGATCAACCCACTGAAGACCACTGTTG

AAGAGTCGCTGTCGCGTGGAATCGCTGGGGAAAATATTAAAATTGGTTCCCAAGCATCTACTGCAGATACTACCTATGTA

GGTGTTGATGCTACCGCAAATAAGCTTGGCACTATTGCTGTGACAATTGGGAACAATGGCGCAGGTACCGTGACTTTCAC

TTTTGCAGCCGGCAATTCCAGTCCGAAAAACTCCGGTAAAATTATCACCCTGACCCGGACTGATGCAGGGTCGTGGGCTT

GTACTTCTACCCAGGACGAAATGTTCATCCCTAAAGGTTGCAAAGCGCCTTAA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(35-148)

Prokaryotic N-terminal methylation motif (N_methyl)

(1-26)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA	Pseudomonas aeruginosa PAK	68.456	99.333	0.68
pilA/pilAI	Pseudomonas stutzeri DSM 10701	47.333	100	0.473
pilA	Vibrio parahaemolyticus RIMD 2210633	46.939	98	0.46
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	43.671	100	0.46
pilA	Vibrio cholerae strain A1552	43.671	100	0.46
pilA	Vibrio cholerae C6706	43.671	100	0.46
pilA	Acinetobacter baumannii strain A118	44.295	99.333	0.44
comP	Acinetobacter baylyi ADP1	41.558	100	0.427
pilA2	Legionella pneumophila strain ERS1305867	42.282	99.333	0.42
pilA/pilAII	Pseudomonas stutzeri DSM 10701	43.357	95.333	0.413
pilA2	Legionella pneumophila str. Paris	41.611	99.333	0.413

Detailed information NTG0769907