NTDB

Overview

Name	ssbA	Type	Machinery gene
Locus tag	OLD84_RS19205	Genome accession	NZ_CP110224
Coordinates	3848284..3848760 (-)	Length	158 a.a.
NCBI ID	WP_209464108.1	Uniprot ID	-
Organism	Virgibacillus natechei strain DSM 25609
Function	ssDNA binding (predicted from homology) DNA processing

Genomic Context

Location: 3843284..3853760

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OLD84_RS19180 (OLD84_19180)	rplI	3843605..3844051 (-)	447	WP_209464104.1	50S ribosomal protein L9	-
OLD84_RS19185 (OLD84_19185)	-	3844048..3846024 (-)	1977	WP_209464105.1	DHH family phosphoesterase	-
OLD84_RS19190 (OLD84_19190)	-	3846056..3847018 (-)	963	WP_209464106.1	YybS family protein	-
OLD84_RS19195 (OLD84_19195)	-	3847346..3847843 (+)	498	WP_245301648.1	DUF1189 family protein	-
OLD84_RS19200 (OLD84_19200)	rpsR	3848025..3848258 (-)	234	WP_209464107.1	30S ribosomal protein S18	-
OLD84_RS19205 (OLD84_19205)	ssbA	3848284..3848760 (-)	477	WP_209464108.1	single-stranded DNA-binding protein	Machinery gene
OLD84_RS19210 (OLD84_19210)	rpsF	3848776..3849066 (-)	291	WP_209464109.1	30S ribosomal protein S6	-
OLD84_RS19215 (OLD84_19215)	ychF	3849287..3850387 (-)	1101	WP_209464110.1	redox-regulated ATPase YchF	-
OLD84_RS19220 (OLD84_19220)	-	3850599..3850796 (-)	198	WP_209464111.1	DUF951 domain-containing protein	-
OLD84_RS19225 (OLD84_19225)	-	3850831..3851733 (-)	903	WP_209464112.1	mechanosensitive ion channel family protein	-
OLD84_RS19230 (OLD84_19230)	-	3851761..3852777 (-)	1017	WP_209464113.1	hypothetical protein	-
OLD84_RS19235 (OLD84_19235)	yyaC	3852865..3853482 (+)	618	WP_209464114.1	spore protease YyaC	-

Sequence

Protein

Download Length: 158 a.a. Molecular weight: 17710.45 Da Isoelectric Point: 4.6132

                                >NTDB_id=753184 OLD84_RS19205 WP_209464108.1 3848284..3848760(-) (ssbA) [Virgibacillus natechei strain DSM 25609]

MLNRVVLVGRLTKDPDLRYTPNGVAVANFTIAVNRPFTNQQGERDADFINCVVWRRPAENLANYMKKGSQIGVDGRLQSR

TFEGQDGKTVFVTEVVADSVQFLESKGASSPDRGQDTSGFQQNRNQFPNQNQNQNQNQEDPFKTNGEPIDISDDDLPF

Nucleotide

Download Length: 477 bp

                                >NTDB_id=753184 OLD84_RS19205 WP_209464108.1 3848284..3848760(-) (ssbA) [Virgibacillus natechei strain DSM 25609]

ATGTTAAATCGTGTCGTACTTGTTGGCAGGTTAACGAAGGATCCTGATCTACGTTATACACCAAACGGAGTAGCAGTAGC

TAATTTTACCATTGCAGTTAATCGACCATTTACCAATCAACAAGGTGAACGTGATGCAGACTTTATTAACTGTGTCGTGT

GGCGCAGACCGGCTGAAAACCTTGCCAACTATATGAAAAAAGGTAGTCAGATTGGTGTTGATGGCCGTCTTCAATCACGT

ACATTTGAAGGACAAGATGGTAAGACCGTATTTGTAACAGAAGTCGTTGCAGACAGTGTGCAATTTCTAGAATCAAAAGG

TGCCTCATCTCCGGATAGGGGACAAGACACATCAGGATTCCAGCAAAATAGAAATCAGTTTCCGAATCAGAACCAAAATC

AGAACCAAAATCAAGAGGACCCATTTAAAACGAATGGAGAGCCTATCGATATATCAGATGATGATTTACCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	62.209	100	0.677
ssb	Latilactobacillus sakei subsp. sakei 23K	55.882	100	0.601
ssbB	Bacillus subtilis subsp. subtilis str. 168	58.491	67.089	0.392
ssbB/cilA	Streptococcus pneumoniae TIGR4	45.802	82.911	0.38
ssbB/cilA	Streptococcus pneumoniae R6	45.038	82.911	0.373
ssbB/cilA	Streptococcus pneumoniae Rx1	45.038	82.911	0.373
ssbB/cilA	Streptococcus pneumoniae D39	45.038	82.911	0.373
ssbB/cilA	Streptococcus mitis SK321	45.038	82.911	0.373
ssb	Neisseria gonorrhoeae MS11	33.714	100	0.373
ssb	Neisseria meningitidis MC58	33.143	100	0.367
ssbB/cilA	Streptococcus mitis NCTC 12261	44.275	82.911	0.367
ssb	Glaesserella parasuis strain SC1401	32.768	100	0.367
ssb	Vibrio cholerae strain A1552	32.759	100	0.361

Detailed information NTG0753184