Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | NW957_RS07260 | Genome accession | NZ_CP102977 |
| Coordinates | 1528674..1528985 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus strain 27-G-H | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1523674..1533985
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NW957_RS07225 (NW957_07225) | gcvPA | 1524176..1525522 (-) | 1347 | WP_000019687.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| NW957_RS07230 (NW957_07230) | gcvT | 1525542..1526633 (-) | 1092 | WP_165468756.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| NW957_RS07235 (NW957_07235) | - | 1526792..1527316 (-) | 525 | WP_001015121.1 | shikimate kinase | - |
| NW957_RS07240 (NW957_07240) | - | 1527306..1527452 (-) | 147 | WP_001789879.1 | hypothetical protein | - |
| NW957_RS07245 (NW957_07245) | comGF | 1527549..1528046 (-) | 498 | WP_001829055.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| NW957_RS07250 (NW957_07250) | comGE | 1527964..1528263 (-) | 300 | WP_000844413.1 | hypothetical protein | Machinery gene |
| NW957_RS07255 (NW957_07255) | comGD | 1528250..1528696 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| NW957_RS07260 (NW957_07260) | comGC | 1528674..1528985 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| NW957_RS07265 (NW957_07265) | comGB | 1528999..1530069 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| NW957_RS07270 (NW957_07270) | comGA | 1530041..1531015 (-) | 975 | WP_000697217.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| NW957_RS07275 (NW957_07275) | - | 1531067..1531690 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| NW957_RS07280 (NW957_07280) | - | 1531687..1532016 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| NW957_RS07285 (NW957_07285) | - | 1532016..1533002 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| NW957_RS07290 (NW957_07290) | - | 1532999..1533202 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=721040 NW957_RS07260 WP_000472256.1 1528674..1528985(-) (comGC) [Staphylococcus aureus strain 27-G-H]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=721040 NW957_RS07260 WP_000472256.1 1528674..1528985(-) (comGC) [Staphylococcus aureus strain 27-G-H]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comYC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |