Detailed information NTG0720327

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: PUW70_RS01155
• Genome accession: NZ_CP118029
• Coordinates: 208294..208611 (+)
• Length: 105 a.a.
• NCBI ID: WP_003028473.1
• Uniprot ID: A0ABS3GG37
• Organism: Streptococcus anginosus strain VSI68
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 203294..213611

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
PUW70_RS01125 (PUW70_01125)	-	203419..203949 (+)	531	WP_070241503.1	aromatic acid exporter family protein	-
PUW70_RS01130 (PUW70_01130)	-	204026..204385 (+)	360	WP_003070793.1	MerR family transcriptional regulator	-
PUW70_RS01135 (PUW70_01135)	glnA	204423..205769 (+)	1347	WP_024053132.1	type I glutamate--ammonia ligase	-
PUW70_RS01140 (PUW70_01140)	-	205957..206322 (+)	366	WP_024053131.1	DUF1033 family protein	-
PUW70_RS01145 (PUW70_01145)	comGA	206392..207333 (+)	942	WP_024053130.1	competence type IV pilus ATPase ComGA	Machinery gene
PUW70_RS01150 (PUW70_01150)	comGB	207275..208297 (+)	1023	WP_171021869.1	competence type IV pilus assembly protein ComGB	Machinery gene
PUW70_RS01155 (PUW70_01155)	comGC	208294..208611 (+)	318	WP_003028473.1	competence type IV pilus major pilin ComGC	Machinery gene
PUW70_RS01160 (PUW70_01160)	comGD	208601..208999 (+)	399	WP_022525973.1	competence type IV pilus minor pilin ComGD	Machinery gene
PUW70_RS01165 (PUW70_01165)	comGE/cglE	208971..209264 (+)	294	WP_024053127.1	competence type IV pilus minor pilin ComGE	Machinery gene
PUW70_RS01170 (PUW70_01170)	comGF/cglF	209248..209685 (+)	438	WP_024053126.1	competence type IV pilus minor pilin ComGF	Machinery gene
PUW70_RS01175 (PUW70_01175)	comGG/cglG	209666..209992 (+)	327	WP_257360478.1	competence type IV pilus minor pilin ComGG	Machinery gene
PUW70_RS01180 (PUW70_01180)	comGH	210064..211017 (+)	954	WP_024053125.1	class I SAM-dependent methyltransferase	Machinery gene
PUW70_RS01185 (PUW70_01185)	-	211064..212263 (+)	1200	WP_024053124.1	acetate kinase	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11622.72 Da
• Isoelectric Point: 10.1006

>NTDB_id=720327 PUW70_RS01155 WP_003028473.1 208294..208611(+) (comGC) [Streptococcus anginosus strain VSI68]
MKKLKSLKVKGFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLVNEGT
ITDKQAASYKAYYAKHTKEARSVAD

Nucleotide

• Length: 318 bp

>NTDB_id=720327 PUW70_RS01155 WP_003028473.1 208294..208611(+) (comGC) [Streptococcus anginosus strain VSI68]
ATGAAAAAATTAAAAAGTTTGAAGGTTAAAGGTTTTACTTTAGTAGAAATGTTAGTCGTGCTTCTTATCATCAGTGTTTT
GATGCTCTTATTTGTACCGAATTTGACCAAGCAAAAAGAAGCTGTAACGGAAAAAGGAAATGCAGCGGTGGTAAAAGTTG
TGGAAAGCCAGGCAGAGCTGTTTGAGGTCAATCACACCAATGAAAAAGCGACACTCTCAAAATTAGTCAACGAAGGAACG
ATTACAGACAAGCAGGCAGCATCTTATAAGGCTTACTATGCGAAACATACAAAAGAAGCTCGTTCTGTTGCAGATTAA

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Streptococcus gordonii str. Challis substr. CH1	73.333	100	0.733
comGC	Streptococcus mutans UA159	66.667	100	0.667
comGC	Streptococcus mutans UA140	66.667	100	0.667
comGC/cglC	Streptococcus mitis NCTC 12261	68.627	97.143	0.667
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comGC	Streptococcus suis isolate S10	66.292	84.762	0.562
comGC	Lactococcus lactis subsp. cremoris KW2	54.808	99.048	0.543