Detailed information NTG0071919

Bioinformatically predicted

Overview

• Name: comX/comX2
• Type: Regulator
• Locus tag: EL263_RS00070
• Genome accession: NZ_AP018938
• Coordinates: 15668..16147 (+)
• Length: 159 a.a.
• NCBI ID: WP_000588874.1
• Uniprot ID: A0AA44S6A3
• Organism: Streptococcus pneumoniae strain ATCC 49619
• Function: activate transcription of late competence genes (predicted from homology) Competence regulation

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	14197..15444	15668..16147	flank	224

Gene organization within MGE regions

Location: 14197..16147

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EL263_RS00065 (SPAT_0014)	-	14197..15444 (-)	1248	WP_114880800.1	ISL3 family transposase	-
EL263_RS00070 (SPAT_0015)	comX/comX2	15668..16147 (+)	480	WP_000588874.1	sigma-70 family RNA polymerase sigma factor	Regulator

Sequence

Protein

• Length: 159 a.a.
• Molecular weight: 19845.50 Da
• Isoelectric Point: 7.3795

>NTDB_id=71919 EL263_RS00070 WP_000588874.1 15668..16147(+) (comX/comX2) [Streptococcus pneumoniae strain ATCC 49619]
MIKELYEEVQGTVYKCRNEYYLHLWELSDWDQEGMLCLHELISREEGLVDDIPRLRKYFKTKFRNRILDYIRKQESQKRK
YDKEPYEEVGELSHRISEGGLWLDDYYLFHETLRDYRNKQSKEKQEELERVLSNERFRGRQRVLRDLRIVFKEFTIRTH

Nucleotide

• Length: 480 bp

>NTDB_id=71919 EL263_RS00070 WP_000588874.1 15668..16147(+) (comX/comX2) [Streptococcus pneumoniae strain ATCC 49619]
ATGATTAAAGAATTGTATGAAGAAGTCCAAGGGACTGTTTATAAGTGTAGAAATGAATATTACCTTCATTTATGGGAATT
GTCGGATTGGGACCAAGAAGGCATGCTCTGCTTACATGAATTGATTAGTAGAGAAGAAGGACTGGTAGACGATATTCCAC
GTTTAAGGAAATATTTCAAAACCAAGTTTCGAAATCGAATTTTAGACTATATCCGTAAGCAGGAAAGTCAGAAGCGTAAA
TACGATAAAGAACCCTATGAAGAAGTGGGTGAGCTCAGTCATCGTATAAGTGAGGGGGGTCTCTGGCTAGATGATTATTA
TCTCTTTCATGAAACACTAAGAGATTATAGAAACAAACAAAGTAAAGAGAAACAAGAAGAACTAGAACGCGTCTTAAGCA
ATGAACGATTTCGAGGGCGTCAAAGAGTATTAAGAGACTTACGCATTGTGTTTAAGGAGTTTACTATCCGTACCCACTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comX/comX2	Streptococcus pneumoniae Rx1	98.742	100	0.987
comX/comX1	Streptococcus pneumoniae Rx1	98.742	100	0.987
comX/comX2	Streptococcus pneumoniae D39	98.742	100	0.987
comX/comX1	Streptococcus pneumoniae D39	98.742	100	0.987
comX/comX2	Streptococcus pneumoniae R6	98.742	100	0.987
comX/comX1	Streptococcus pneumoniae R6	98.742	100	0.987
comX/comX2	Streptococcus pneumoniae TIGR4	98.113	100	0.981
comX/comX1	Streptococcus pneumoniae TIGR4	98.113	100	0.981
comX/sigX/comX1/sigX1	Streptococcus mitis NCTC 12261	91.195	100	0.912
comX/sigX/comX2/sigX2	Streptococcus mitis NCTC 12261	91.195	100	0.912
comX/sigX/comX2/sigX2	Streptococcus mitis SK321	89.308	100	0.893
comX/sigX/comX1/sigX1	Streptococcus mitis SK321	87.975	99.371	0.874
comR/comR2	Streptococcus gordonii str. Challis substr. CH1	48.718	98.113	0.478
comR/comR1	Streptococcus gordonii str. Challis substr. CH1	48.718	98.113	0.478
comX/sigX	Streptococcus suis D9	47.02	94.969	0.447
comX/sigX	Streptococcus suis isolate S10	47.02	94.969	0.447
comX/sigX	Streptococcus suis P1/7	47.02	94.969	0.447
comX/sigX	Streptococcus mutans UA159	44.667	94.34	0.421
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS315	39.216	96.226	0.377
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS315	39.216	96.226	0.377
comX/sigX/comX2/sigX2	Streptococcus pyogenes JRS4	40	94.34	0.377
comX/sigX/comX1/sigX1	Streptococcus pyogenes JRS4	40	94.34	0.377
comX/sigX/comX2/sigX2	Streptococcus pyogenes MGAS8232	40	94.34	0.377
comX/sigX/comX1/sigX1	Streptococcus pyogenes MGAS8232	40	94.34	0.377