Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | NQZ93_RS07485 | Genome accession | NZ_CP102141 |
| Coordinates | 1524938..1525336 (-) | Length | 132 a.a. |
| NCBI ID | WP_172011734.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain DNR48 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1506679..1549335 | 1524938..1525336 | within | 0 |
Gene organization within MGE regions
Location: 1506679..1549335
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NQZ93_RS07325 (NQZ93_07325) | - | 1506679..1507623 (-) | 945 | WP_024381603.1 | bifunctional oligoribonuclease/PAP phosphatase NrnA | - |
| NQZ93_RS07330 (NQZ93_07330) | - | 1507718..1508179 (+) | 462 | WP_012775265.1 | flavodoxin | - |
| NQZ93_RS07335 (NQZ93_07335) | rpsN | 1508320..1508589 (+) | 270 | WP_002940393.1 | 30S ribosomal protein S14 | - |
| NQZ93_RS07340 (NQZ93_07340) | - | 1508671..1508949 (+) | 279 | WP_024381604.1 | chorismate mutase | - |
| NQZ93_RS07345 (NQZ93_07345) | - | 1508939..1510153 (+) | 1215 | WP_024381605.1 | chloride channel protein | - |
| NQZ93_RS07350 (NQZ93_07350) | - | 1510146..1510331 (-) | 186 | WP_257115211.1 | minor capsid protein | - |
| NQZ93_RS07355 (NQZ93_07355) | - | 1510333..1510728 (-) | 396 | WP_104929714.1 | hypothetical protein | - |
| NQZ93_RS07360 (NQZ93_07360) | - | 1510752..1510943 (-) | 192 | WP_044683112.1 | hypothetical protein | - |
| NQZ93_RS07365 (NQZ93_07365) | - | 1510959..1511771 (-) | 813 | WP_044773180.1 | N4-gp56 family major capsid protein | - |
| NQZ93_RS07370 (NQZ93_07370) | - | 1511773..1512375 (-) | 603 | WP_257115213.1 | hypothetical protein | - |
| NQZ93_RS07375 (NQZ93_07375) | - | 1512537..1512788 (-) | 252 | WP_024390611.1 | DUF6275 family protein | - |
| NQZ93_RS07380 (NQZ93_07380) | - | 1512799..1513032 (-) | 234 | WP_044684408.1 | hypothetical protein | - |
| NQZ93_RS07385 (NQZ93_07385) | - | 1513029..1513349 (-) | 321 | WP_044752553.1 | hypothetical protein | - |
| NQZ93_RS07390 (NQZ93_07390) | - | 1513402..1513677 (-) | 276 | WP_044684405.1 | hypothetical protein | - |
| NQZ93_RS07395 (NQZ93_07395) | - | 1513664..1515313 (-) | 1650 | WP_044684403.1 | phage minor capsid protein | - |
| NQZ93_RS07400 (NQZ93_07400) | - | 1515306..1516793 (-) | 1488 | WP_257115214.1 | phage portal protein | - |
| NQZ93_RS07405 (NQZ93_07405) | - | 1516804..1518102 (-) | 1299 | WP_257115216.1 | PBSX family phage terminase large subunit | - |
| NQZ93_RS07410 (NQZ93_07410) | - | 1518089..1518580 (-) | 492 | WP_032510250.1 | terminase small subunit | - |
| NQZ93_RS07425 (NQZ93_07425) | - | 1519063..1519524 (-) | 462 | WP_043028989.1 | DUF1492 domain-containing protein | - |
| NQZ93_RS07430 (NQZ93_07430) | mazE | 1519704..1519919 (+) | 216 | WP_024379772.1 | type II toxin-antitoxin system PemI/MazE family antitoxin | - |
| NQZ93_RS07435 (NQZ93_07435) | - | 1519909..1520253 (+) | 345 | WP_029694196.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| NQZ93_RS07440 (NQZ93_07440) | - | 1520250..1520444 (-) | 195 | WP_172011797.1 | hypothetical protein | - |
| NQZ93_RS07445 (NQZ93_07445) | - | 1520444..1520599 (-) | 156 | WP_153602296.1 | hypothetical protein | - |
| NQZ93_RS07450 (NQZ93_07450) | - | 1520596..1520973 (-) | 378 | WP_172011805.1 | hypothetical protein | - |
| NQZ93_RS07455 (NQZ93_07455) | - | 1520986..1521528 (-) | 543 | WP_257115217.1 | DUF1642 domain-containing protein | - |
| NQZ93_RS07460 (NQZ93_07460) | - | 1521521..1521904 (-) | 384 | WP_172049005.1 | DUF1642 domain-containing protein | - |
| NQZ93_RS07465 (NQZ93_07465) | - | 1521901..1522176 (-) | 276 | WP_044689630.1 | DUF1372 family protein | - |
| NQZ93_RS07470 (NQZ93_07470) | - | 1522203..1522358 (-) | 156 | WP_171992161.1 | hypothetical protein | - |
| NQZ93_RS07475 (NQZ93_07475) | - | 1522737..1524116 (-) | 1380 | WP_079396020.1 | virulence-associated E family protein | - |
| NQZ93_RS07480 (NQZ93_07480) | - | 1524100..1524927 (-) | 828 | WP_172011736.1 | bifunctional DNA primase/polymerase | - |
| NQZ93_RS07485 (NQZ93_07485) | ssbA | 1524938..1525336 (-) | 399 | WP_172011734.1 | single-stranded DNA-binding protein | Machinery gene |
| NQZ93_RS07490 (NQZ93_07490) | - | 1525333..1525629 (-) | 297 | WP_172011732.1 | hypothetical protein | - |
| NQZ93_RS07495 (NQZ93_07495) | - | 1525629..1526327 (-) | 699 | WP_172008602.1 | ERF family protein | - |
| NQZ93_RS07500 (NQZ93_07500) | - | 1526337..1526657 (-) | 321 | WP_172008603.1 | hypothetical protein | - |
| NQZ93_RS07505 (NQZ93_07505) | - | 1526681..1527853 (-) | 1173 | WP_172011730.1 | DEAD/DEAH box helicase family protein | - |
| NQZ93_RS07510 (NQZ93_07510) | - | 1527822..1528202 (-) | 381 | WP_249547584.1 | hypothetical protein | - |
| NQZ93_RS07515 (NQZ93_07515) | - | 1528283..1528765 (-) | 483 | WP_172011728.1 | siphovirus Gp157 family protein | - |
| NQZ93_RS07520 (NQZ93_07520) | - | 1528749..1529345 (-) | 597 | WP_172011726.1 | HNH endonuclease signature motif containing protein | - |
| NQZ93_RS07525 (NQZ93_07525) | - | 1529338..1529571 (-) | 234 | WP_172011724.1 | hypothetical protein | - |
| NQZ93_RS07530 (NQZ93_07530) | - | 1529571..1529912 (-) | 342 | WP_013730169.1 | hypothetical protein | - |
| NQZ93_RS07535 (NQZ93_07535) | - | 1529922..1530068 (-) | 147 | WP_161948697.1 | hypothetical protein | - |
| NQZ93_RS07540 (NQZ93_07540) | - | 1530058..1530333 (-) | 276 | WP_024377134.1 | hypothetical protein | - |
| NQZ93_RS07545 (NQZ93_07545) | - | 1530687..1530878 (-) | 192 | WP_024377489.1 | helix-turn-helix transcriptional regulator | - |
| NQZ93_RS07550 (NQZ93_07550) | - | 1531061..1531279 (+) | 219 | WP_061767953.1 | hypothetical protein | - |
| NQZ93_RS07555 (NQZ93_07555) | - | 1531262..1531405 (-) | 144 | WP_099780081.1 | hypothetical protein | - |
| NQZ93_RS07560 (NQZ93_07560) | - | 1531474..1532196 (+) | 723 | WP_044687746.1 | hypothetical protein | - |
| NQZ93_RS07565 (NQZ93_07565) | - | 1532189..1532425 (-) | 237 | WP_032511618.1 | hypothetical protein | - |
| NQZ93_RS07570 (NQZ93_07570) | - | 1532464..1532592 (-) | 129 | WP_257115219.1 | hypothetical protein | - |
| NQZ93_RS07575 (NQZ93_07575) | - | 1532762..1532992 (-) | 231 | WP_024390598.1 | transcriptional regulator | - |
| NQZ93_RS07580 (NQZ93_07580) | - | 1533177..1533320 (-) | 144 | WP_153309404.1 | hypothetical protein | - |
| NQZ93_RS07585 (NQZ93_07585) | - | 1533484..1534236 (+) | 753 | WP_257115220.1 | XRE family transcriptional regulator | - |
| NQZ93_RS07590 (NQZ93_07590) | - | 1534288..1534710 (+) | 423 | WP_024379796.1 | hypothetical protein | - |
| NQZ93_RS07595 (NQZ93_07595) | - | 1534710..1535132 (+) | 423 | WP_024377495.1 | hypothetical protein | - |
| NQZ93_RS07600 (NQZ93_07600) | - | 1535205..1535852 (+) | 648 | WP_044667238.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| NQZ93_RS07605 (NQZ93_07605) | - | 1536120..1537214 (+) | 1095 | WP_172049003.1 | tyrosine-type recombinase/integrase | - |
| NQZ93_RS07615 (NQZ93_07615) | - | 1537519..1539543 (-) | 2025 | WP_029693857.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| NQZ93_RS07620 (NQZ93_07620) | sodA | 1539805..1540410 (-) | 606 | WP_024381607.1 | superoxide dismutase SodA | - |
| NQZ93_RS07625 (NQZ93_07625) | holA | 1540523..1541554 (-) | 1032 | WP_024381608.1 | DNA polymerase III subunit delta | - |
| NQZ93_RS07630 (NQZ93_07630) | - | 1541704..1542294 (-) | 591 | WP_013730461.1 | hypothetical protein | - |
| NQZ93_RS07635 (NQZ93_07635) | - | 1542402..1543157 (-) | 756 | WP_002937287.1 | epoxyqueuosine reductase QueH | - |
| NQZ93_RS07640 (NQZ93_07640) | - | 1543528..1544238 (-) | 711 | WP_002937288.1 | ABC transporter ATP-binding protein | - |
| NQZ93_RS07645 (NQZ93_07645) | - | 1544238..1545002 (-) | 765 | WP_002937291.1 | ABC transporter ATP-binding protein | - |
| NQZ93_RS07650 (NQZ93_07650) | - | 1545002..1545949 (-) | 948 | WP_257115221.1 | branched-chain amino acid ABC transporter permease | - |
| NQZ93_RS07655 (NQZ93_07655) | - | 1545952..1546839 (-) | 888 | WP_002937296.1 | branched-chain amino acid ABC transporter permease | - |
| NQZ93_RS07660 (NQZ93_07660) | - | 1547045..1548214 (-) | 1170 | WP_002937297.1 | ABC transporter substrate-binding protein | - |
| NQZ93_RS07665 (NQZ93_07665) | - | 1548346..1548618 (-) | 273 | WP_024390621.1 | YlbG family protein | - |
| NQZ93_RS07670 (NQZ93_07670) | clpP | 1548745..1549335 (-) | 591 | WP_024390620.1 | ATP-dependent Clp protease proteolytic subunit | Regulator |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 14816.36 Da Isoelectric Point: 4.6582
>NTDB_id=714853 NQZ93_RS07485 WP_172011734.1 1524938..1525336(-) (ssbA) [Streptococcus suis strain DNR48]
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFVNCVIWRQQAENLANWAKKGALIGVTGRIQTR
SYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGTSGNSSPMDIQDEDLPF
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFVNCVIWRQQAENLANWAKKGALIGVTGRIQTR
SYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGTSGNSSPMDIQDEDLPF
Nucleotide
Download Length: 399 bp
>NTDB_id=714853 NQZ93_RS07485 WP_172011734.1 1524938..1525336(-) (ssbA) [Streptococcus suis strain DNR48]
ATGATTAACAACGTAGTATTGGTAGGACGCATGACTCGTGATGCAGAACTTCGTTACACTCCGTCAAACCAGGCGGTTGC
GACTTTTACCCTTGCTGTCAATCGAAACTTCAAAAACCAAGATGGGGAGCGTGAAGCAGATTTCGTCAACTGTGTCATTT
GGCGTCAACAAGCCGAAAACTTGGCAAACTGGGCTAAGAAAGGTGCTCTGATTGGTGTTACTGGTCGTATTCAGACTCGT
AGCTATGACAACCAACAAGGGCAACGTGTCTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTTTTGGAAAGTCGTGG
ACAGCAGTCGAATTCTCAAGACGGAACATCTGGAAATTCAAGCCCAATGGATATCCAAGACGAAGATTTGCCGTTCTAG
ATGATTAACAACGTAGTATTGGTAGGACGCATGACTCGTGATGCAGAACTTCGTTACACTCCGTCAAACCAGGCGGTTGC
GACTTTTACCCTTGCTGTCAATCGAAACTTCAAAAACCAAGATGGGGAGCGTGAAGCAGATTTCGTCAACTGTGTCATTT
GGCGTCAACAAGCCGAAAACTTGGCAAACTGGGCTAAGAAAGGTGCTCTGATTGGTGTTACTGGTCGTATTCAGACTCGT
AGCTATGACAACCAACAAGGGCAACGTGTCTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTTTTGGAAAGTCGTGG
ACAGCAGTCGAATTCTCAAGACGGAACATCTGGAAATTCAAGCCCAATGGATATCCAAGACGAAGATTTGCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.689 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.674 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
49.242 |
100 |
0.492 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.97 |
100 |
0.47 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
46.212 |
100 |
0.462 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
46.212 |
100 |
0.462 |
| ssbB/cilA | Streptococcus mitis SK321 |
46.212 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
46.212 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
46.212 |
100 |
0.462 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.963 |
82.576 |
0.462 |
| ssbA | Streptococcus mutans UA159 |
43.939 |
100 |
0.439 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
47.17 |
80.303 |
0.379 |
| ssb | Vibrio cholerae strain A1552 |
28.324 |
100 |
0.371 |