Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | NNM43_RS04010 | Genome accession | NZ_CP101538 |
| Coordinates | 833994..834431 (+) | Length | 145 a.a. |
| NCBI ID | WP_005686916.1 | Uniprot ID | - |
| Organism | Lacticaseibacillus rhamnosus strain HN067 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 826728..867555 | 833994..834431 | within | 0 |
Gene organization within MGE regions
Location: 826728..867555
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NNM43_RS03950 (NNM43_03950) | - | 826728..827855 (-) | 1128 | WP_005686887.1 | site-specific integrase | - |
| NNM43_RS03955 (NNM43_03955) | - | 828030..828707 (-) | 678 | WP_005686889.1 | hypothetical protein | - |
| NNM43_RS03960 (NNM43_03960) | - | 828764..829438 (-) | 675 | WP_005686890.1 | LexA family transcriptional regulator | - |
| NNM43_RS03965 (NNM43_03965) | - | 829600..829845 (+) | 246 | WP_005686894.1 | helix-turn-helix transcriptional regulator | - |
| NNM43_RS03970 (NNM43_03970) | - | 829842..830567 (+) | 726 | WP_005686896.1 | phage regulatory protein | - |
| NNM43_RS03975 (NNM43_03975) | - | 830615..830971 (+) | 357 | WP_003572199.1 | DUF771 domain-containing protein | - |
| NNM43_RS03980 (NNM43_03980) | - | 831056..831208 (+) | 153 | WP_005686904.1 | hypothetical protein | - |
| NNM43_RS03985 (NNM43_03985) | - | 831213..831416 (+) | 204 | WP_005686906.1 | hypothetical protein | - |
| NNM43_RS03990 (NNM43_03990) | - | 831434..831925 (+) | 492 | WP_005686909.1 | siphovirus Gp157 family protein | - |
| NNM43_RS03995 (NNM43_03995) | - | 831936..832691 (+) | 756 | WP_005686911.1 | ERF family protein | - |
| NNM43_RS04000 (NNM43_04000) | - | 832688..833356 (+) | 669 | WP_005686913.1 | putative HNHc nuclease | - |
| NNM43_RS04005 (NNM43_04005) | - | 833370..833918 (+) | 549 | WP_005686914.1 | NUMOD4 domain-containing protein | - |
| NNM43_RS04010 (NNM43_04010) | ssb | 833994..834431 (+) | 438 | WP_005686916.1 | single-stranded DNA-binding protein | Machinery gene |
| NNM43_RS04015 (NNM43_04015) | - | 834448..835281 (+) | 834 | WP_005686918.1 | helix-turn-helix domain-containing protein | - |
| NNM43_RS04020 (NNM43_04020) | - | 835278..836540 (+) | 1263 | WP_005686920.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| NNM43_RS04025 (NNM43_04025) | - | 836542..836886 (+) | 345 | WP_005686922.1 | hypothetical protein | - |
| NNM43_RS04030 (NNM43_04030) | - | 836899..837177 (+) | 279 | WP_005686924.1 | helix-turn-helix domain-containing protein | - |
| NNM43_RS04035 (NNM43_04035) | - | 837174..837623 (+) | 450 | WP_005686926.1 | hypothetical protein | - |
| NNM43_RS04040 (NNM43_04040) | - | 837626..838009 (+) | 384 | WP_005686928.1 | DUF1064 domain-containing protein | - |
| NNM43_RS04045 (NNM43_04045) | - | 838021..838131 (+) | 111 | WP_005686930.1 | hypothetical protein | - |
| NNM43_RS04050 (NNM43_04050) | - | 838223..838978 (+) | 756 | WP_005686931.1 | site-specific DNA-methyltransferase | - |
| NNM43_RS04055 (NNM43_04055) | - | 839120..839506 (+) | 387 | WP_306460883.1 | DUF1642 domain-containing protein | - |
| NNM43_RS04060 (NNM43_04060) | - | 839496..839867 (+) | 372 | WP_005686935.1 | hypothetical protein | - |
| NNM43_RS04065 (NNM43_04065) | - | 839864..840253 (+) | 390 | WP_005686937.1 | hypothetical protein | - |
| NNM43_RS04070 (NNM43_04070) | - | 840250..840438 (+) | 189 | WP_005686939.1 | hypothetical protein | - |
| NNM43_RS04075 (NNM43_04075) | - | 840504..840923 (+) | 420 | WP_005686941.1 | YopX family protein | - |
| NNM43_RS04080 (NNM43_04080) | - | 841353..841796 (+) | 444 | WP_005686946.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| NNM43_RS04085 (NNM43_04085) | - | 842084..842944 (+) | 861 | WP_005686948.1 | hypothetical protein | - |
| NNM43_RS04090 (NNM43_04090) | - | 843485..844633 (+) | 1149 | WP_005686951.1 | GcrA family cell cycle regulator | - |
| NNM43_RS04095 (NNM43_04095) | - | 844646..845176 (+) | 531 | WP_005686953.1 | NUMOD4 domain-containing protein | - |
| NNM43_RS04100 (NNM43_04100) | - | 845180..845500 (+) | 321 | WP_005686955.1 | hypothetical protein | - |
| NNM43_RS04105 (NNM43_04105) | - | 845503..845826 (+) | 324 | WP_005686957.1 | hypothetical protein | - |
| NNM43_RS04110 (NNM43_04110) | - | 845844..846008 (+) | 165 | WP_005686959.1 | hypothetical protein | - |
| NNM43_RS04115 (NNM43_04115) | - | 846045..846839 (+) | 795 | WP_005686961.1 | HNH endonuclease | - |
| NNM43_RS04120 (NNM43_04120) | - | 847039..847494 (+) | 456 | WP_005686963.1 | P27 family phage terminase small subunit | - |
| NNM43_RS04125 (NNM43_04125) | - | 847516..849228 (+) | 1713 | WP_005686965.1 | terminase large subunit | - |
| NNM43_RS04130 (NNM43_04130) | - | 849240..849431 (+) | 192 | WP_003661399.1 | hypothetical protein | - |
| NNM43_RS04135 (NNM43_04135) | - | 849437..850690 (+) | 1254 | WP_005686969.1 | phage portal protein | - |
| NNM43_RS04140 (NNM43_04140) | - | 850644..851273 (+) | 630 | WP_015764348.1 | HK97 family phage prohead protease | - |
| NNM43_RS04145 (NNM43_04145) | - | 851315..852517 (+) | 1203 | WP_005686973.1 | phage major capsid protein | - |
| NNM43_RS04150 (NNM43_04150) | - | 852535..852774 (+) | 240 | WP_005686975.1 | Ig-like domain-containing protein | - |
| NNM43_RS04155 (NNM43_04155) | - | 852785..853144 (+) | 360 | WP_005686976.1 | head-tail connector protein | - |
| NNM43_RS04160 (NNM43_04160) | - | 853134..853463 (+) | 330 | WP_005686978.1 | head-tail adaptor protein | - |
| NNM43_RS04165 (NNM43_04165) | - | 853463..853849 (+) | 387 | WP_005686980.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| NNM43_RS04170 (NNM43_04170) | - | 853849..854235 (+) | 387 | WP_005686982.1 | hypothetical protein | - |
| NNM43_RS04175 (NNM43_04175) | - | 854269..854889 (+) | 621 | WP_005686984.1 | major tail protein | - |
| NNM43_RS04180 (NNM43_04180) | - | 854946..855131 (+) | 186 | WP_005686987.1 | Ig-like domain-containing protein | - |
| NNM43_RS04185 (NNM43_04185) | gpG | 855202..855615 (+) | 414 | WP_003661382.1 | phage tail assembly chaperone G | - |
| NNM43_RS04190 (NNM43_04190) | - | 855738..860600 (+) | 4863 | WP_005686989.1 | phage tail tape measure protein | - |
| NNM43_RS04195 (NNM43_04195) | - | 860601..862523 (+) | 1923 | WP_005686991.1 | distal tail protein Dit | - |
| NNM43_RS04200 (NNM43_04200) | - | 862523..865030 (+) | 2508 | WP_005686993.1 | phage tail protein | - |
| NNM43_RS04205 (NNM43_04205) | - | 865040..865363 (+) | 324 | WP_005686996.1 | hypothetical protein | - |
| NNM43_RS04210 | - | 865356..865487 (+) | 132 | WP_014569499.1 | XkdX family protein | - |
| NNM43_RS04215 (NNM43_04215) | - | 865517..865807 (+) | 291 | WP_005686998.1 | hypothetical protein | - |
| NNM43_RS04220 (NNM43_04220) | - | 865800..866246 (+) | 447 | WP_005687000.1 | phage holin | - |
| NNM43_RS04225 (NNM43_04225) | - | 866257..867555 (+) | 1299 | WP_005687002.1 | LysM peptidoglycan-binding domain-containing protein | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 15964.61 Da Isoelectric Point: 5.1662
>NTDB_id=710498 NNM43_RS04010 WP_005686916.1 833994..834431(+) (ssb) [Lacticaseibacillus rhamnosus strain HN067]
MLNTVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQKVFVTEVIVENFALLEPRQASQDGQQRSANNPAAAIQGNSFANNGQPVDIRDDDLPF
MLNTVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFINCAIWRKSAENFANFTHKGSLVGIEGHIQTR
TYDNAQGQKVFVTEVIVENFALLEPRQASQDGQQRSANNPAAAIQGNSFANNGQPVDIRDDDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=710498 NNM43_RS04010 WP_005686916.1 833994..834431(+) (ssb) [Lacticaseibacillus rhamnosus strain HN067]
ATGTTAAACACAGTTGCTTTAACAGGTCGATTAACCAAAGATGTTGATCTTCGCTATACACAAAGCGGAACAGCAGTTGG
CTCATTTACGATTGCTGTTGATCGCCAATTTCGCAGCGCAAACGGCGAACGTGAAACTGACTTCATCAATTGTGCCATCT
GGCGTAAGTCTGCTGAGAACTTTGCCAACTTCACGCACAAGGGTTCACTTGTTGGCATCGAAGGCCATATCCAAACGCGT
ACGTATGATAACGCGCAAGGGCAGAAAGTATTCGTGACCGAGGTAATCGTTGAGAATTTTGCTTTGCTTGAGCCACGGCA
AGCGTCTCAGGATGGTCAACAACGATCGGCTAATAACCCAGCGGCCGCAATCCAAGGCAACAGTTTTGCCAACAATGGTC
AGCCAGTCGATATCAGGGATGATGATCTTCCATTCTAA
ATGTTAAACACAGTTGCTTTAACAGGTCGATTAACCAAAGATGTTGATCTTCGCTATACACAAAGCGGAACAGCAGTTGG
CTCATTTACGATTGCTGTTGATCGCCAATTTCGCAGCGCAAACGGCGAACGTGAAACTGACTTCATCAATTGTGCCATCT
GGCGTAAGTCTGCTGAGAACTTTGCCAACTTCACGCACAAGGGTTCACTTGTTGGCATCGAAGGCCATATCCAAACGCGT
ACGTATGATAACGCGCAAGGGCAGAAAGTATTCGTGACCGAGGTAATCGTTGAGAATTTTGCTTTGCTTGAGCCACGGCA
AGCGTCTCAGGATGGTCAACAACGATCGGCTAATAACCCAGCGGCCGCAATCCAAGGCAACAGTTTTGCCAACAATGGTC
AGCCAGTCGATATCAGGGATGATGATCTTCCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
57.059 |
100 |
0.669 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
46.857 |
100 |
0.566 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.774 |
73.103 |
0.393 |
| ssb | Neisseria meningitidis MC58 |
32.37 |
100 |
0.386 |
| ssb | Neisseria gonorrhoeae MS11 |
32.37 |
100 |
0.386 |
| ssb | Vibrio cholerae strain A1552 |
31.214 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.241 |
100 |
0.372 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
36.552 |
100 |
0.366 |
| ssbB/cilA | Streptococcus mitis SK321 |
36.552 |
100 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
36.552 |
100 |
0.366 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
36.552 |
100 |
0.366 |