Detailed information NTG0070711

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: H7679_RS01045
• Genome accession: NZ_AP023392
• Coordinates: 162159..162419 (+)
• Length: 86 a.a.
• NCBI ID: WP_184495877.1
• Uniprot ID: -
• Organism: Streptococcus suis strain DAT300
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 157159..167419

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
H7679_RS01015 (DAT300_01690)	-	157941..160013 (+)	2073	WP_184495869.1	DUF859 family phage minor structural protein	-
H7679_RS01020 (DAT300_01700)	-	160075..160341 (+)	267	WP_184495871.1	hypothetical protein	-
H7679_RS01025 (DAT300_01710)	-	160354..160809 (+)	456	WP_184495873.1	hypothetical protein	-
H7679_RS01030 (DAT300_01720)	-	160784..160987 (+)	204	WP_029751977.1	phage holin	-
H7679_RS01035 (DAT300_01730)	-	161117..161827 (+)	711	WP_184495875.1	CHAP domain-containing protein	-
H7679_RS01040 (DAT300_01740)	prx	161973..162158 (+)	186	WP_016056161.1	hypothetical protein	Regulator
H7679_RS01045 (DAT300_01750)	comGC	162159..162419 (+)	261	WP_184495877.1	competence type IV pilus major pilin ComGC	Machinery gene
H7679_RS01050 (DAT300_01760)	comGD	162400..162807 (+)	408	WP_024395446.1	competence type IV pilus minor pilin ComGD	Machinery gene
H7679_RS01055 (DAT300_01770)	comGE	162779..163072 (+)	294	WP_024394703.1	competence type IV pilus minor pilin ComGE	Machinery gene
H7679_RS01060 (DAT300_01780)	comGF/cglF	163059..163493 (+)	435	WP_014637316.1	competence type IV pilus minor pilin ComGF	Machinery gene
H7679_RS01065 (DAT300_01790)	comGG	163471..163881 (+)	411	WP_044676305.1	competence type IV pilus minor pilin ComGG	-
H7679_RS01070 (DAT300_01800)	comGH	163938..164891 (+)	954	WP_184495879.1	class I SAM-dependent methyltransferase	Machinery gene
H7679_RS01075 (DAT300_01810)	-	164941..166128 (+)	1188	WP_024401510.1	acetate kinase	-
H7679_RS01080 (DAT300_01820)	-	166443..166994 (+)	552	WP_024395442.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 86 a.a.
• Molecular weight: 9541.99 Da
• Isoelectric Point: 4.0742

>NTDB_id=70711 H7679_RS01045 WP_184495877.1 162159..162419(+) (comGC) [Streptococcus suis strain DAT300]
MSYLDTLIEMLVVLGIISLLLLLFVPNLSQQKDAVQEKGNAAVVKVVESQMELYELEHDEEATVADLQAAGYITEKQAKQ
YATAEK

Nucleotide

• Length: 261 bp

>NTDB_id=70711 H7679_RS01045 WP_184495877.1 162159..162419(+) (comGC) [Streptococcus suis strain DAT300]
ATGTCATATTTAGATACACTGATTGAAATGTTAGTCGTTTTGGGGATCATTAGCCTGCTCTTGCTCCTTTTTGTGCCAAA
TTTGAGCCAGCAGAAGGATGCTGTTCAAGAGAAAGGAAATGCTGCGGTTGTCAAAGTAGTAGAGAGCCAGATGGAGCTCT
ATGAATTGGAACATGACGAGGAAGCAACGGTGGCAGACTTGCAGGCAGCTGGCTACATCACTGAAAAACAAGCAAAACAG
TATGCTACGGCGGAAAAATAA

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Streptococcus suis isolate S10	92.593	94.186	0.872
comGC/cglC	Streptococcus pneumoniae TIGR4	69.737	88.372	0.616
comGC/cglC	Streptococcus pneumoniae Rx1	69.737	88.372	0.616
comGC/cglC	Streptococcus pneumoniae D39	69.737	88.372	0.616
comGC/cglC	Streptococcus pneumoniae R6	69.737	88.372	0.616
comGC/cglC	Streptococcus mitis NCTC 12261	69.737	88.372	0.616
comGC/cglC	Streptococcus mitis SK321	69.737	88.372	0.616
comGC	Streptococcus gordonii str. Challis substr. CH1	66.234	89.535	0.593
comGC	Streptococcus mutans UA140	65.789	88.372	0.581
comGC	Streptococcus mutans UA159	65.789	88.372	0.581
comGC	Lactococcus lactis subsp. cremoris KW2	61.039	89.535	0.547
comGC	Staphylococcus aureus N315	50.685	84.884	0.43
comGC	Staphylococcus aureus MW2	50.685	84.884	0.43