Detailed information NTG0672169

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MUA94_RS06115
• Genome accession: NZ_CP094768
• Coordinates: 1217647..1217958 (+)
• Length: 103 a.a.
• NCBI ID: WP_262538680.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain IVB6202
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1212647..1222958

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MUA94_RS06085 (MUA94_06075)	-	1213430..1213633 (+)	204	WP_000087561.1	YqgQ family protein	-
MUA94_RS06090 (MUA94_06080)	-	1213630..1214616 (+)	987	WP_000161315.1	ROK family glucokinase	-
MUA94_RS06095 (MUA94_06085)	-	1214616..1214945 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
MUA94_RS06100 (MUA94_06090)	-	1214942..1215565 (+)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
MUA94_RS06105 (MUA94_06095)	comGA	1215617..1216591 (+)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
MUA94_RS06110 (MUA94_06100)	comGB	1216563..1217633 (+)	1071	WP_262538679.1	competence type IV pilus assembly protein ComGB	Machinery gene
MUA94_RS06115 (MUA94_06105)	comGC	1217647..1217958 (+)	312	WP_262538680.1	competence type IV pilus major pilin ComGC	Machinery gene
MUA94_RS06120 (MUA94_06110)	comGD	1217936..1218382 (+)	447	WP_001796473.1	competence type IV pilus minor pilin ComGD	Machinery gene
MUA94_RS06125 (MUA94_06115)	comGE	1218369..1218668 (+)	300	WP_000844413.1	hypothetical protein	Machinery gene
MUA94_RS06130 (MUA94_06120)	comGF	1218586..1219083 (+)	498	WP_258411170.1	competence type IV pilus minor pilin ComGF	Machinery gene
MUA94_RS06135 (MUA94_06125)	-	1219180..1219326 (+)	147	WP_001789879.1	hypothetical protein	-
MUA94_RS06140 (MUA94_06130)	-	1219316..1219840 (+)	525	WP_001015120.1	shikimate kinase	-
MUA94_RS06145 (MUA94_06135)	gcvT	1219999..1221090 (+)	1092	WP_262538681.1	glycine cleavage system aminomethyltransferase GcvT	-
MUA94_RS06150 (MUA94_06140)	gcvPA	1221110..1222456 (+)	1347	WP_262538682.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11343.41 Da
• Isoelectric Point: 8.5268

>NTDB_id=672169 MUA94_RS06115 WP_262538680.1 1217647..1217958(+) (comGC) [Staphylococcus aureus strain IVB6202]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYVLKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=672169 MUA94_RS06115 WP_262538680.1 1217647..1217958(+) (comGC) [Staphylococcus aureus strain IVB6202]
ATGTTTAAATTTCTAAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGTATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGTGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC/cglC	Streptococcus mitis SK321	47.059	99.029	0.466
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369