Detailed information NTG0654827

Bioinformatically predicted

Overview

• Name: pilA2
• Type: Machinery gene
• Locus tag: L8M16_RS13955
• Genome accession: NZ_CP091977
• Coordinates: 2914634..2915059 (-)
• Length: 141 a.a.
• NCBI ID: WP_168955045.1
• Uniprot ID: -
• Organism: Aromatoleum aromaticum strain pCyN1
• Function: assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2909634..2920059

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
L8M16_RS13905	-	2909634..2910629 (-)	996	WP_251199479.1	hypothetical protein	-
L8M16_RS13910	-	2910626..2910967 (-)	342	WP_168955084.1	hypothetical protein	-
L8M16_RS13915	-	2911080..2911352 (-)	273	WP_168955085.1	hypothetical protein	-
L8M16_RS13920	-	2911380..2911892 (-)	513	WP_168955086.1	hypothetical protein	-
L8M16_RS13925	-	2912179..2912694 (-)	516	WP_251199480.1	phage regulatory CII family protein	-
L8M16_RS13930	-	2912813..2913121 (+)	309	WP_168955041.1	hypothetical protein	-
L8M16_RS13935	-	2913172..2913339 (-)	168	WP_168955042.1	hypothetical protein	-
L8M16_RS13940	-	2913342..2913608 (-)	267	WP_168955043.1	hypothetical protein	-
L8M16_RS13945	-	2913609..2913890 (-)	282	WP_168955040.1	hypothetical protein	-
L8M16_RS13950	-	2913995..2914522 (+)	528	WP_168955044.1	hypothetical protein	-
L8M16_RS13955	pilA2	2914634..2915059 (-)	426	WP_168955045.1	pilin	Machinery gene
L8M16_RS13965	-	2915271..2915813 (+)	543	WP_168955046.1	tetratricopeptide repeat protein	-
L8M16_RS13970	-	2915952..2916353 (+)	402	WP_251199481.1	hypothetical protein	-
L8M16_RS13975	-	2916372..2916596 (+)	225	WP_168954625.1	hypothetical protein	-
L8M16_RS13980	-	2916664..2917935 (+)	1272	WP_168954623.1	hypothetical protein	-
L8M16_RS13985	-	2917932..2918525 (+)	594	WP_168954621.1	hypothetical protein	-
L8M16_RS13990	-	2918522..2918953 (+)	432	WP_168954619.1	hypothetical protein	-
L8M16_RS13995	-	2918950..2919375 (+)	426	WP_168954617.1	hypothetical protein	-
L8M16_RS14000	-	2919372..2919695 (+)	324	WP_041645328.1	hypothetical protein	-

Sequence

Protein

• Length: 141 a.a.
• Molecular weight: 13925.10 Da
• Isoelectric Point: 8.1144

>NTDB_id=654827 L8M16_RS13955 WP_168955045.1 2914634..2915059(-) (pilA2) [Aromatoleum aromaticum strain pCyN1]
MKKAQQGFTLIELMIVVAIIGILAAVALPAYQDYTVRAHVSEGLNLAGGAKNAVSDAYASNGALPTTNAAAGLPEATAIA
GNAVTSITVGANGAIAILYNAKAKAGTCTLTPSVANAGSMTWGCACTTLTAGQVPKICTVS

Nucleotide

• Length: 426 bp

>NTDB_id=654827 L8M16_RS13955 WP_168955045.1 2914634..2915059(-) (pilA2) [Aromatoleum aromaticum strain pCyN1]
ATGAAAAAGGCACAACAGGGCTTTACCCTGATCGAACTGATGATCGTCGTCGCGATCATCGGCATTCTGGCGGCGGTGGC
GCTGCCGGCATATCAGGATTACACGGTCCGCGCTCATGTATCAGAGGGGCTGAACCTTGCGGGAGGGGCGAAGAATGCGG
TCTCTGACGCCTACGCGTCGAACGGCGCTCTGCCTACAACCAACGCAGCAGCCGGGCTTCCGGAAGCTACTGCCATTGCG
GGTAATGCAGTGACATCGATTACTGTCGGTGCAAACGGCGCAATCGCTATTCTATACAACGCTAAAGCGAAGGCCGGGAC
GTGCACACTGACCCCTTCGGTCGCAAATGCCGGTTCAATGACGTGGGGATGTGCCTGCACAACCCTCACCGCCGGTCAGG
TGCCAAAAATTTGCACAGTTTCCTGA

Domains

Predicted by InterproScan.

• Pilin (bacterial filament) (Pilin) (36-139)

• Prokaryotic N-terminal methylation motif (N_methyl) (2-28)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
pilA2	Legionella pneumophila str. Paris	56.618	96.454	0.546
pilA2	Legionella pneumophila strain ERS1305867	56.618	96.454	0.546
comP	Acinetobacter baylyi ADP1	48.98	100	0.511
pilA/pilA1	Eikenella corrodens VA1	45.455	100	0.461
pilA	Vibrio campbellii strain DS40M4	43.972	100	0.44
pilA	Ralstonia pseudosolanacearum GMI1000	44.286	99.291	0.44
pilE	Neisseria gonorrhoeae MS11	46.923	92.199	0.433
pilE	Neisseria gonorrhoeae strain FA1090	45.312	90.78	0.411
pilA	Vibrio cholerae strain A1552	37.324	100	0.376
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	37.324	100	0.376
pilA	Vibrio cholerae C6706	37.324	100	0.376
pilA	Haemophilus influenzae Rd KW20	35.417	100	0.362