Detailed information NTG0646585

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LZT96_RS06280
• Genome accession: NZ_CP090941
• Coordinates: 1296730..1297047 (+)
• Length: 105 a.a.
• NCBI ID: WP_001831271.1
• Uniprot ID: A0A9Q5JKE9
• Organism: Staphylococcus epidermidis strain HAF242
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1291730..1302047

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LZT96_RS06250 (LZT96_06250)	-	1292507..1292707 (+)	201	WP_002446537.1	YqgQ family protein	-
LZT96_RS06255 (LZT96_06255)	-	1292707..1293693 (+)	987	WP_002473556.1	ROK family glucokinase	-
LZT96_RS06260 (LZT96_06260)	-	1293693..1294019 (+)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
LZT96_RS06265 (LZT96_06265)	-	1294019..1294642 (+)	624	WP_002446535.1	MBL fold metallo-hydrolase	-
LZT96_RS06270 (LZT96_06270)	comGA	1294699..1295673 (+)	975	WP_002497933.1	competence type IV pilus ATPase ComGA	Machinery gene
LZT96_RS06275 (LZT96_06275)	comGB	1295645..1296712 (+)	1068	WP_002497932.1	competence type IV pilus assembly protein ComGB	Machinery gene
LZT96_RS06280 (LZT96_06280)	comGC	1296730..1297047 (+)	318	WP_001831271.1	competence type IV pilus major pilin ComGC	Machinery gene
LZT96_RS06285 (LZT96_06285)	comGD	1297037..1297474 (+)	438	WP_002497931.1	competence type IV pilus minor pilin ComGD	-
LZT96_RS06290 (LZT96_06290)	-	1297461..1297754 (+)	294	WP_001831116.1	hypothetical protein	-
LZT96_RS06295 (LZT96_06295)	comGF	1297678..1298169 (+)	492	WP_002497930.1	competence type IV pilus minor pilin ComGF	-
LZT96_RS06300 (LZT96_06300)	-	1298334..1298846 (+)	513	WP_002497929.1	shikimate kinase	-
LZT96_RS06305 (LZT96_06305)	gcvT	1299064..1300155 (+)	1092	WP_002497928.1	glycine cleavage system aminomethyltransferase GcvT	-
LZT96_RS06310 (LZT96_06310)	gcvPA	1300175..1301521 (+)	1347	WP_002473606.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11491.58 Da
• Isoelectric Point: 9.7429

>NTDB_id=646585 LZT96_RS06280 WP_001831271.1 1296730..1297047(+) (comGC) [Staphylococcus epidermidis strain HAF242]
MKTLKLLKKTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=646585 LZT96_RS06280 WP_001831271.1 1296730..1297047(+) (comGC) [Staphylococcus epidermidis strain HAF242]
ATGAAAACATTGAAATTATTGAAAAAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATAAGTTT
ATTGTTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTATGCTTTAAAACATAATCGCAACCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAGGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	87.255	97.143	0.848
comGC	Staphylococcus aureus N315	87.255	97.143	0.848
comGC/cglC	Streptococcus mitis SK321	44.66	98.095	0.438
comGC/cglC	Streptococcus pneumoniae TIGR4	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae Rx1	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae D39	44.681	89.524	0.4
comGC/cglC	Streptococcus pneumoniae R6	44.681	89.524	0.4
comYC	Streptococcus mutans UA159	47.674	81.905	0.39
comYC	Streptococcus mutans UA140	47.674	81.905	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC	Lactococcus lactis subsp. cremoris KW2	47.561	78.095	0.371
comGC/cglC	Streptococcus mitis NCTC 12261	50	74.286	0.371
comYC	Streptococcus suis isolate S10	48.718	74.286	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362