Detailed information
Overview
| Name | pilE | Type | Machinery gene |
| Locus tag | LRK53_RS06010 | Genome accession | NZ_CP088923 |
| Coordinates | 1387525..1387980 (-) | Length | 151 a.a. |
| NCBI ID | WP_027493018.1 | Uniprot ID | - |
| Organism | Rhodanobacter thiooxydans strain FW510-R12 | ||
| Function | assembly of type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 1374734..1397082 | 1387525..1387980 | within | 0 |
Gene organization within MGE regions
Location: 1374734..1397082
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LRK53_RS05945 (LRK53_05945) | - | 1374734..1374976 (+) | 243 | WP_027493027.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| LRK53_RS05950 (LRK53_05950) | - | 1374973..1375368 (+) | 396 | WP_027493026.1 | type II toxin-antitoxin system VapC family toxin | - |
| LRK53_RS05955 (LRK53_05955) | - | 1375524..1375850 (-) | 327 | WP_051257590.1 | DUF86 domain-containing protein | - |
| LRK53_RS05960 (LRK53_05960) | - | 1375889..1376179 (-) | 291 | WP_027493024.1 | nucleotidyltransferase family protein | - |
| LRK53_RS05965 (LRK53_05965) | - | 1376511..1377365 (+) | 855 | WP_027493023.1 | glycosyltransferase family 2 protein | - |
| LRK53_RS05970 (LRK53_05970) | - | 1377358..1378518 (+) | 1161 | WP_027493022.1 | glycosyltransferase family 4 protein | - |
| LRK53_RS05975 (LRK53_05975) | - | 1378511..1379281 (+) | 771 | WP_081666625.1 | class I SAM-dependent methyltransferase | - |
| LRK53_RS05980 (LRK53_05980) | - | 1379278..1380345 (+) | 1068 | WP_081666624.1 | glycosyltransferase family 4 protein | - |
| LRK53_RS05985 (LRK53_05985) | - | 1380357..1381358 (+) | 1002 | WP_037089869.1 | class I SAM-dependent methyltransferase | - |
| LRK53_RS05990 (LRK53_05990) | - | 1381358..1382209 (+) | 852 | WP_185754653.1 | glycosyltransferase | - |
| LRK53_RS05995 (LRK53_05995) | - | 1382206..1383456 (-) | 1251 | WP_051257587.1 | oligosaccharide flippase family protein | - |
| LRK53_RS06000 (LRK53_06000) | - | 1383453..1385438 (-) | 1986 | WP_051257586.1 | hypothetical protein | - |
| LRK53_RS06005 (LRK53_06005) | - | 1385438..1387453 (-) | 2016 | WP_235642652.1 | tetratricopeptide repeat protein | - |
| LRK53_RS06010 (LRK53_06010) | pilE | 1387525..1387980 (-) | 456 | WP_027493018.1 | pilin | Machinery gene |
| LRK53_RS06015 (LRK53_06015) | pilA | 1388325..1388768 (-) | 444 | WP_027493017.1 | pilin | Machinery gene |
| LRK53_RS06020 (LRK53_06020) | - | 1388922..1389239 (-) | 318 | WP_185754656.1 | DUF86 domain-containing protein | - |
| LRK53_RS06025 (LRK53_06025) | - | 1389308..1389544 (-) | 237 | WP_235642561.1 | nucleotidyltransferase domain-containing protein | - |
| LRK53_RS06030 (LRK53_06030) | - | 1389569..1390297 (-) | 729 | WP_051257585.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| LRK53_RS06035 (LRK53_06035) | - | 1390290..1390760 (-) | 471 | WP_235642562.1 | helix-turn-helix domain-containing protein | - |
| LRK53_RS06040 (LRK53_06040) | - | 1390866..1391105 (-) | 240 | WP_051257583.1 | HigA family addiction module antitoxin | - |
| LRK53_RS06045 (LRK53_06045) | - | 1391176..1391316 (-) | 141 | Protein_1204 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LRK53_RS06050 (LRK53_06050) | - | 1391480..1391866 (-) | 387 | WP_037089861.1 | nucleotidyltransferase domain-containing protein | - |
| LRK53_RS06055 (LRK53_06055) | - | 1392134..1392748 (+) | 615 | WP_027493013.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | - |
| LRK53_RS06060 (LRK53_06060) | - | 1392773..1393636 (+) | 864 | WP_037089858.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| LRK53_RS06065 (LRK53_06065) | - | 1393835..1395964 (+) | 2130 | WP_027493012.1 | S9 family peptidase | - |
| LRK53_RS06070 (LRK53_06070) | - | 1396666..1397082 (+) | 417 | WP_235642563.1 | nucleotidyltransferase family protein | - |
Sequence
Protein
Download Length: 151 a.a. Molecular weight: 15446.81 Da Isoelectric Point: 9.7085
>NTDB_id=634017 LRK53_RS06010 WP_027493018.1 1387525..1387980(-) (pilE) [Rhodanobacter thiooxydans strain FW510-R12]
MKSMQKGFTLIELMIVVAIIAILAAIAIPAYQDYLIRTQVSEGAVLADGAKTAVAEFFSNTGRMPAANQSVGLATPHSIT
GSYVGSVTVGTNGLITVKYGTDGGAAGTGAKANSKIVGNTLLLSAQTNTGSISWACKSASVDKKYLPTSCR
MKSMQKGFTLIELMIVVAIIAILAAIAIPAYQDYLIRTQVSEGAVLADGAKTAVAEFFSNTGRMPAANQSVGLATPHSIT
GSYVGSVTVGTNGLITVKYGTDGGAAGTGAKANSKIVGNTLLLSAQTNTGSISWACKSASVDKKYLPTSCR
Nucleotide
Download Length: 456 bp
>NTDB_id=634017 LRK53_RS06010 WP_027493018.1 1387525..1387980(-) (pilE) [Rhodanobacter thiooxydans strain FW510-R12]
ATGAAGAGTATGCAGAAAGGCTTTACCCTGATCGAACTGATGATCGTGGTCGCGATCATCGCGATCCTCGCCGCTATCGC
CATTCCGGCCTATCAGGACTACCTGATCCGCACGCAGGTTTCTGAAGGCGCTGTTCTTGCCGATGGCGCCAAGACCGCGG
TAGCCGAGTTCTTCAGCAACACGGGCAGAATGCCTGCCGCTAACCAGTCGGTTGGTCTCGCCACGCCCCACAGCATCACC
GGTAGCTATGTCGGCAGCGTTACGGTCGGAACCAATGGCCTTATCACCGTCAAGTATGGTACCGATGGCGGTGCCGCTGG
AACCGGTGCCAAGGCTAATTCGAAAATCGTCGGTAATACGCTTCTGCTTTCCGCGCAAACCAACACCGGCAGTATCTCGT
GGGCTTGTAAGTCCGCTTCTGTGGATAAAAAGTACCTGCCGACTTCGTGCCGTTGA
ATGAAGAGTATGCAGAAAGGCTTTACCCTGATCGAACTGATGATCGTGGTCGCGATCATCGCGATCCTCGCCGCTATCGC
CATTCCGGCCTATCAGGACTACCTGATCCGCACGCAGGTTTCTGAAGGCGCTGTTCTTGCCGATGGCGCCAAGACCGCGG
TAGCCGAGTTCTTCAGCAACACGGGCAGAATGCCTGCCGCTAACCAGTCGGTTGGTCTCGCCACGCCCCACAGCATCACC
GGTAGCTATGTCGGCAGCGTTACGGTCGGAACCAATGGCCTTATCACCGTCAAGTATGGTACCGATGGCGGTGCCGCTGG
AACCGGTGCCAAGGCTAATTCGAAAATCGTCGGTAATACGCTTCTGCTTTCCGCGCAAACCAACACCGGCAGTATCTCGT
GGGCTTGTAAGTCCGCTTCTGTGGATAAAAAGTACCTGCCGACTTCGTGCCGTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilE | Neisseria elongata subsp. glycolytica ATCC 29315 |
38.776 |
100 |
0.503 |
| pilE | Neisseria gonorrhoeae MS11 |
42.262 |
100 |
0.47 |
| pilA | Ralstonia pseudosolanacearum GMI1000 |
41.818 |
100 |
0.457 |
| pilE | Neisseria gonorrhoeae strain FA1090 |
41.317 |
100 |
0.457 |
| pilA2 | Legionella pneumophila str. Paris |
45.638 |
98.675 |
0.45 |
| pilA2 | Legionella pneumophila strain ERS1305867 |
45.638 |
98.675 |
0.45 |
| comP | Acinetobacter baylyi ADP1 |
41.667 |
100 |
0.43 |
| pilA/pilA1 | Eikenella corrodens VA1 |
37.267 |
100 |
0.397 |
| pilA | Pseudomonas aeruginosa PAK |
36.709 |
100 |
0.384 |
| pilA | Acinetobacter baumannii strain A118 |
38.776 |
97.351 |
0.377 |
| pilA/pilAI | Pseudomonas stutzeri DSM 10701 |
38.255 |
98.675 |
0.377 |
| pilA | Haemophilus influenzae 86-028NP |
36.913 |
98.675 |
0.364 |