NTDB

Overview

Name	comGC	Type	Machinery gene
Locus tag	LO769_RS10990	Genome accession	NZ_CP087600
Coordinates	2159776..2160159 (-)	Length	127 a.a.
NCBI ID	WP_081040865.1	Uniprot ID	-
Organism	Lactococcus lactis subsp. lactis strain IBB109
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2154776..2165159

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LO769_RS10950 (LO769_10945)	-	2155287..2156096 (-)	810	WP_014570791.1	metal ABC transporter permease	-
LO769_RS10955 (LO769_10950)	-	2156089..2156826 (-)	738	WP_058221575.1	metal ABC transporter ATP-binding protein	-
LO769_RS10960 (LO769_10955)	-	2157003..2157845 (-)	843	WP_003129990.1	metal ABC transporter substrate-binding protein	-
LO769_RS10965 (LO769_10960)	-	2157842..2158279 (-)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
LO769_RS10970 (LO769_10965)	comGG	2158385..2158669 (-)	285	WP_003129993.1	competence type IV pilus minor pilin ComGG	Machinery gene
LO769_RS10975 (LO769_10970)	comGF	2158708..2159154 (-)	447	WP_029344525.1	competence type IV pilus minor pilin ComGF	Machinery gene
LO769_RS10980 (LO769_10975)	comGE	2159117..2159413 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
LO769_RS10985 (LO769_10980)	comGD	2159385..2159816 (-)	432	WP_080585155.1	competence type IV pilus minor pilin ComGD	Machinery gene
LO769_RS10990 (LO769_10985)	comGC	2159776..2160159 (-)	384	WP_081040865.1	competence type IV pilus major pilin ComGC	Machinery gene
LO769_RS10995 (LO769_10990)	comGB	2160173..2161246 (-)	1074	WP_014570824.1	competence type IV pilus assembly protein ComGB	Machinery gene
LO769_RS11000 (LO769_10995)	comGA	2161140..2162079 (-)	940	Protein_2136	competence type IV pilus ATPase ComGA	-

Sequence

Protein

Download Length: 127 a.a. Molecular weight: 14807.43 Da Isoelectric Point: 8.4538

                                >NTDB_id=630380 LO769_RS10990 WP_081040865.1 2159776..2160159(-) (comGC) [Lactococcus lactis subsp. lactis strain IBB109]

MERTKKFILKKIQKIFLFVKICEKKCRQKELKAFTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQA

QLYELDHDDEKPSLPELLSAGMITQKQISAYDNYYDQNKNEERNFND

Nucleotide

Download Length: 384 bp

                                >NTDB_id=630380 LO769_RS10990 WP_081040865.1 2159776..2160159(-) (comGC) [Lactococcus lactis subsp. lactis strain IBB109]

ATGGAAAGAACAAAGAAGTTTATTTTAAAAAAAATACAAAAAATATTTTTATTCGTTAAAATTTGTGAAAAAAAATGCCG

TCAGAAAGAGCTAAAAGCTTTTACTTTGATAGAGATGTTAATTGTACTAGCTATTATTAGTATTTTAATATTACTATTTG

TTCCAAATTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCT

CAACTTTATGAATTAGATCATGATGATGAGAAGCCGAGTCTGCCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACA

AATTTCTGCTTACGATAATTACTATGATCAGAACAAAAATGAAGAACGAAATTTTAATGACTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(32-52)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comGC	Lactococcus lactis subsp. cremoris KW2	80.172	91.339	0.732
comGC/cglC	Streptococcus mitis SK321	55.446	79.528	0.441
comYC	Streptococcus gordonii str. Challis substr. CH1	55.556	77.953	0.433
comGC/cglC	Streptococcus pneumoniae R6	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae Rx1	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae D39	54.455	79.528	0.433
comYC	Streptococcus mutans UA140	54.455	79.528	0.433
comYC	Streptococcus mutans UA159	54.455	79.528	0.433
comGC/cglC	Streptococcus mitis NCTC 12261	57.303	70.079	0.402
comYC	Streptococcus suis isolate S10	56.818	69.291	0.394

Detailed information NTG0630380