Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   LO769_RS10970 Genome accession   NZ_CP087600
Coordinates   2158385..2158669 (-) Length   94 a.a.
NCBI ID   WP_003129993.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain IBB109     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2153385..2163669
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LO769_RS10940 (LO769_10935) - 2153801..2154178 (-) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -
  LO769_RS10945 (LO769_10940) - 2154382..2155248 (+) 867 WP_153927515.1 RluA family pseudouridine synthase -
  LO769_RS10950 (LO769_10945) - 2155287..2156096 (-) 810 WP_014570791.1 metal ABC transporter permease -
  LO769_RS10955 (LO769_10950) - 2156089..2156826 (-) 738 WP_058221575.1 metal ABC transporter ATP-binding protein -
  LO769_RS10960 (LO769_10955) - 2157003..2157845 (-) 843 WP_003129990.1 metal ABC transporter substrate-binding protein -
  LO769_RS10965 (LO769_10960) - 2157842..2158279 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  LO769_RS10970 (LO769_10965) comGG 2158385..2158669 (-) 285 WP_003129993.1 competence type IV pilus minor pilin ComGG Machinery gene
  LO769_RS10975 (LO769_10970) comGF 2158708..2159154 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  LO769_RS10980 (LO769_10975) comGE 2159117..2159413 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LO769_RS10985 (LO769_10980) comGD 2159385..2159816 (-) 432 WP_080585155.1 competence type IV pilus minor pilin ComGD Machinery gene
  LO769_RS10990 (LO769_10985) comGC 2159776..2160159 (-) 384 WP_081040865.1 competence type IV pilus major pilin ComGC Machinery gene
  LO769_RS10995 (LO769_10990) comGB 2160173..2161246 (-) 1074 WP_014570824.1 competence type IV pilus assembly protein ComGB Machinery gene
  LO769_RS11000 (LO769_10995) comGA 2161140..2162079 (-) 940 Protein_2136 competence type IV pilus ATPase ComGA -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10783.02 Da        Isoelectric Point: 5.0604

>NTDB_id=630376 LO769_RS10970 WP_003129993.1 2158385..2158669(-) (comGG) [Lactococcus lactis subsp. lactis strain IBB109]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGANFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=630376 LO769_RS10970 WP_003129993.1 2158385..2158669(-) (comGG) [Lactococcus lactis subsp. lactis strain IBB109]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGAGATT
TGTCCTACAATTTACTGACAGATTCGTCAGCCAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCGCAAACTTTCAAATAAAAAAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585