Detailed information NTG0621430

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: LK450_RS08265
• Genome accession: NZ_CP085939
• Coordinates: 1672095..1672412 (+)
• Length: 105 a.a.
• NCBI ID: WP_003026997.1
• Uniprot ID: -
• Organism: Streptococcus anginosus subsp. anginosus strain FDAARGOS_1569
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1667095..1677412

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LK450_RS08235 (LK450_08235)	-	1667219..1667749 (+)	531	WP_003032280.1	aromatic acid exporter family protein	-
LK450_RS08240 (LK450_08240)	-	1667826..1668185 (+)	360	WP_003028467.1	MerR family transcriptional regulator	-
LK450_RS08245 (LK450_08245)	glnA	1668224..1669570 (+)	1347	WP_003032299.1	type I glutamate--ammonia ligase	-
LK450_RS08250 (LK450_08250)	-	1669758..1670123 (+)	366	WP_003032307.1	DUF1033 family protein	-
LK450_RS08255 (LK450_08255)	comYA	1670193..1671134 (+)	942	WP_003032308.1	competence type IV pilus ATPase ComGA	Machinery gene
LK450_RS08260 (LK450_08260)	comYB	1671076..1672098 (+)	1023	WP_037582505.1	competence type IV pilus assembly protein ComGB	Machinery gene
LK450_RS08265 (LK450_08265)	comYC	1672095..1672412 (+)	318	WP_003026997.1	competence type IV pilus major pilin ComGC	Machinery gene
LK450_RS08270 (LK450_08270)	comYD	1672372..1672800 (+)	429	WP_050791305.1	competence type IV pilus minor pilin ComGD	Machinery gene
LK450_RS08275 (LK450_08275)	comGE/cglE	1672772..1673065 (+)	294	WP_003032294.1	competence type IV pilus minor pilin ComGE	Machinery gene
LK450_RS08280 (LK450_08280)	comGF/cglF	1673049..1673486 (+)	438	WP_003032293.1	competence type IV pilus minor pilin ComGF	Machinery gene
LK450_RS08285 (LK450_08285)	comGG	1673467..1673793 (+)	327	WP_018543596.1	competence type IV pilus minor pilin ComGG	-
LK450_RS08290 (LK450_08290)	comYH	1673878..1674831 (+)	954	WP_003032282.1	class I SAM-dependent methyltransferase	Machinery gene
LK450_RS08295 (LK450_08295)	-	1674878..1676077 (+)	1200	WP_003032291.1	acetate kinase	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11636.74 Da
• Isoelectric Point: 10.1006

>NTDB_id=621430 LK450_RS08265 WP_003026997.1 1672095..1672412(+) (comYC) [Streptococcus anginosus subsp. anginosus strain FDAARGOS_1569]
MKKLKSLKVKGFTLVEMLVVLLIISVLMLLFVPNLTKQKEAVTEKGNAAVVKVVESQAELFEVNHTNEKATLSKLINEGT
ITDKQAASYKAYYAKHTKEARSVAD

Nucleotide

• Length: 318 bp

>NTDB_id=621430 LK450_RS08265 WP_003026997.1 1672095..1672412(+) (comYC) [Streptococcus anginosus subsp. anginosus strain FDAARGOS_1569]
ATGAAAAAATTAAAAAGTTTGAAAGTTAAAGGTTTTACTTTAGTAGAAATGTTAGTCGTGCTTCTTATTATCAGTGTTTT
GATGCTCTTGTTCGTGCCGAATTTGACCAAGCAAAAAGAAGCGGTGACGGAAAAAGGAAATGCAGCGGTGGTAAAAGTTG
TGGAAAGCCAGGCAGAGCTGTTTGAGGTTAATCACACCAATGAAAAAGCGACACTCTCAAAATTAATCAACGAAGGCACG
ATTACAGACAAGCAGGCAGCATCTTATAAGGCTTACTATGCGAAACATACAAAAGAAGCTCGTTCTGTTGCAGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (8-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus gordonii str. Challis substr. CH1	72.381	100	0.724
comGC/cglC	Streptococcus mitis NCTC 12261	68.627	97.143	0.667
comGC/cglC	Streptococcus mitis SK321	68.627	97.143	0.667
comYC	Streptococcus mutans UA140	65.714	100	0.657
comYC	Streptococcus mutans UA159	65.714	100	0.657
comGC/cglC	Streptococcus pneumoniae R6	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae TIGR4	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae Rx1	66.667	97.143	0.648
comGC/cglC	Streptococcus pneumoniae D39	66.667	97.143	0.648
comYC	Streptococcus suis isolate S10	66.292	84.762	0.562
comGC	Lactococcus lactis subsp. cremoris KW2	54.808	99.048	0.543