Detailed information NTG0619720

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: NW949_RS07370
• Genome accession: NZ_CP102960
• Coordinates: 1553224..1553499 (-)
• Length: 91 a.a.
• NCBI ID: WP_258415261.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain 07-G-D
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1548224..1558499

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
NW949_RS07330 (NW949_07330)	-	1549103..1549627 (-)	525	WP_001015123.1	shikimate kinase	-
NW949_RS07335 (NW949_07335)	-	1549617..1549763 (-)	147	WP_001789879.1	hypothetical protein	-
NW949_RS07340 (NW949_07340)	comGF	1549860..1550357 (-)	498	WP_029694050.1	competence type IV pilus minor pilin ComGF	Machinery gene
NW949_RS07345 (NW949_07345)	comGE	1550275..1550574 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
NW949_RS07350 (NW949_07350)	comGD	1550561..1551007 (-)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
NW949_RS07355 (NW949_07355)	-	1550985..1551050 (-)	66	Protein_1441	competence protein ComGC	-
NW949_RS07360 (NW949_07360)	istB	1551112..1551879 (-)	768	WP_001095317.1	IS21-like element helper ATPase IstB	-
NW949_RS07365 (NW949_07365)	istA	1551891..1553126 (-)	1236	WP_258410791.1	IS21 family transposase	-
NW949_RS07370 (NW949_07370)	comGC	1553224..1553499 (-)	276	WP_258415261.1	competence type IV pilus major pilin ComGC	Machinery gene
NW949_RS07375 (NW949_07375)	comGB	1553513..1554583 (-)	1071	WP_000776422.1	competence type IV pilus assembly protein ComGB	Machinery gene
NW949_RS07380 (NW949_07380)	comGA	1554555..1555529 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
NW949_RS07385 (NW949_07385)	-	1555581..1556204 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
NW949_RS07390 (NW949_07390)	-	1556201..1556530 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
NW949_RS07395 (NW949_07395)	-	1556530..1557516 (-)	987	WP_000161315.1	ROK family glucokinase	-
NW949_RS07400 (NW949_07400)	-	1557513..1557716 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 91 a.a.
• Molecular weight: 10169.14 Da
• Isoelectric Point: 9.6595

>NTDB_id=619720 NW949_RS07370 WP_258415261.1 1553224..1553499(-) (comGC) [Staphylococcus aureus strain 07-G-D]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAHVNGGYKM

Nucleotide

• Length: 276 bp

>NTDB_id=619720 NW949_RS07370 WP_258415261.1 1553224..1553499(-) (comGC) [Staphylococcus aureus strain 07-G-D]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACATGTAAATGGCGGTTATAAAATGTAG

Domains

Predicted by InterProScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	98.81	92.308	0.912
comGC	Staphylococcus aureus N315	98.81	92.308	0.912
comGC/cglC	Streptococcus mitis SK321	46.465	100	0.505
comGC/cglC	Streptococcus pneumoniae R6	45.455	100	0.495
comGC/cglC	Streptococcus pneumoniae D39	45.455	100	0.495
comGC/cglC	Streptococcus pneumoniae TIGR4	45.455	100	0.495
comGC/cglC	Streptococcus pneumoniae Rx1	45.455	100	0.495
comGC/cglC	Streptococcus mitis NCTC 12261	48.913	100	0.495
comGC	Streptococcus suis isolate S10	47.5	87.912	0.418
comGC	Streptococcus gordonii str. Challis substr. CH1	44.048	92.308	0.407
comGC	Lactococcus lactis subsp. cremoris KW2	46.25	87.912	0.407
comGC	Streptococcus mutans UA140	46.835	86.813	0.407
comGC	Streptococcus mutans UA159	46.835	86.813	0.407
comGC	Bacillus subtilis subsp. subtilis str. 168	42.857	84.615	0.363