Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LIO34_RS02315 | Genome accession | NZ_CP085085 |
| Coordinates | 437483..437881 (+) | Length | 132 a.a. |
| NCBI ID | WP_022540565.1 | Uniprot ID | A0A0K2E4A3 |
| Organism | Streptococcus suis strain Ssuis_MA8 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 429047..452088 | 437483..437881 | within | 0 |
Gene organization within MGE regions
Location: 429047..452088
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LIO34_RS02230 | - | 429047..430204 (-) | 1158 | WP_013730163.1 | site-specific integrase | - |
| LIO34_RS02235 | - | 430401..431132 (-) | 732 | WP_013730164.1 | hypothetical protein | - |
| LIO34_RS02240 | - | 431180..431563 (-) | 384 | WP_013730165.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LIO34_RS02245 | - | 431570..431971 (-) | 402 | WP_307828834.1 | helix-turn-helix transcriptional regulator | - |
| LIO34_RS02250 | - | 432134..432334 (+) | 201 | WP_002937001.1 | helix-turn-helix domain-containing protein | - |
| LIO34_RS02255 | - | 432404..432730 (+) | 327 | WP_013730166.1 | hypothetical protein | - |
| LIO34_RS02260 | - | 432804..433058 (+) | 255 | WP_013730167.1 | hypothetical protein | - |
| LIO34_RS02265 | - | 433099..433347 (+) | 249 | WP_013730168.1 | hypothetical protein | - |
| LIO34_RS02270 | - | 433337..433489 (+) | 153 | WP_022540561.1 | hypothetical protein | - |
| LIO34_RS02275 | - | 433494..433835 (+) | 342 | WP_013730169.1 | hypothetical protein | - |
| LIO34_RS02280 | - | 433835..434314 (+) | 480 | WP_013730170.1 | siphovirus Gp157 family protein | - |
| LIO34_RS02285 | - | 434311..434556 (+) | 246 | WP_013730171.1 | hypothetical protein | - |
| LIO34_RS02290 | - | 434537..435001 (+) | 465 | WP_013730172.1 | hypothetical protein | - |
| LIO34_RS02295 | - | 434970..436142 (+) | 1173 | WP_013730173.1 | DEAD/DEAH box helicase family protein | - |
| LIO34_RS02300 | - | 436216..436482 (+) | 267 | WP_226960629.1 | hypothetical protein | - |
| LIO34_RS02305 | - | 436492..437190 (+) | 699 | WP_013730175.1 | ERF family protein | - |
| LIO34_RS02310 | - | 437190..437486 (+) | 297 | WP_022540564.1 | hypothetical protein | - |
| LIO34_RS02315 | ssbA | 437483..437881 (+) | 399 | WP_022540565.1 | single-stranded DNA-binding protein | Machinery gene |
| LIO34_RS02320 | - | 437892..438719 (+) | 828 | WP_013730177.1 | bifunctional DNA primase/polymerase | - |
| LIO34_RS02325 | - | 438703..440082 (+) | 1380 | WP_079253058.1 | virulence-associated E family protein | - |
| LIO34_RS02330 | - | 440460..440615 (+) | 156 | WP_013730179.1 | hypothetical protein | - |
| LIO34_RS02335 | - | 440612..440920 (+) | 309 | WP_013730180.1 | DUF1372 family protein | - |
| LIO34_RS02340 | - | 440922..441137 (+) | 216 | WP_172005862.1 | hypothetical protein | - |
| LIO34_RS02345 | - | 441326..441640 (+) | 315 | WP_013730182.1 | hypothetical protein | - |
| LIO34_RS02350 | - | 441713..442147 (+) | 435 | WP_002937915.1 | DUF1492 domain-containing protein | - |
| LIO34_RS02355 | - | 442244..442591 (+) | 348 | WP_013730183.1 | HNH endonuclease | - |
| LIO34_RS02360 | - | 442680..443042 (+) | 363 | WP_105203945.1 | hypothetical protein | - |
| LIO34_RS02365 | - | 443039..444304 (+) | 1266 | WP_013730185.1 | phage portal protein | - |
| LIO34_RS02370 | - | 444297..445517 (+) | 1221 | WP_013730186.1 | hypothetical protein | - |
| LIO34_RS02375 | - | 445522..445755 (+) | 234 | WP_022540567.1 | hypothetical protein | - |
| LIO34_RS02380 | - | 445957..447159 (-) | 1203 | WP_009909264.1 | IS110-like element ISSsu7 family transposase | - |
| LIO34_RS02385 | - | 447499..447754 (-) | 256 | Protein_432 | IS110 family transposase | - |
| LIO34_RS02390 | - | 448063..448350 (+) | 288 | Protein_433 | ISL3 family transposase | - |
| LIO34_RS02395 | - | 448874..449512 (-) | 639 | WP_009909540.1 | MBL fold metallo-hydrolase | - |
| LIO34_RS02400 | - | 449620..452088 (+) | 2469 | WP_022540595.1 | bifunctional DnaQ family exonuclease/ATP-dependent helicase | - |
Sequence
Protein
Download Length: 132 a.a. Molecular weight: 14872.45 Da Isoelectric Point: 4.6583
>NTDB_id=615161 LIO34_RS02315 WP_022540565.1 437483..437881(+) (ssbA) [Streptococcus suis strain Ssuis_MA8]
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFINVVIWRQQAENLANWAKKGALIGVTGRIQTR
SYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGSFGNSSPMDIQDEDLPF
MINNVVLVGRMTRDAELRYTPSNQAVATFTLAVNRNFKNQDGEREADFINVVIWRQQAENLANWAKKGALIGVTGRIQTR
SYDNQQGQRVYVTEVVAESFQLLESRGQQSNSQDGSFGNSSPMDIQDEDLPF
Nucleotide
Download Length: 399 bp
>NTDB_id=615161 LIO34_RS02315 WP_022540565.1 437483..437881(+) (ssbA) [Streptococcus suis strain Ssuis_MA8]
ATGATTAACAATGTAGTACTAGTGGGACGCATGACTCGTGATGCAGAACTTCGTTACACTCCGTCAAACCAGGCGGTTGC
GACTTTTACCTTGGCTGTCAATCGAAACTTCAAAAATCAAGATGGGGAGCGTGAAGCGGACTTTATCAACGTAGTCATTT
GGCGTCAACAAGCTGAGAATTTGGCGAATTGGGCTAAGAAAGGTGCTCTGATTGGTGTTACAGGTCGCATTCAGACTCGT
AGCTATGACAATCAACAAGGGCAACGTGTCTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTCTTGGAAAGTCGTGG
ACAACAGTCGAATTCTCAAGACGGATCATTTGGAAATTCAAGTCCTATGGATATCCAAGACGAAGATTTGCCGTTCTAG
ATGATTAACAATGTAGTACTAGTGGGACGCATGACTCGTGATGCAGAACTTCGTTACACTCCGTCAAACCAGGCGGTTGC
GACTTTTACCTTGGCTGTCAATCGAAACTTCAAAAATCAAGATGGGGAGCGTGAAGCGGACTTTATCAACGTAGTCATTT
GGCGTCAACAAGCTGAGAATTTGGCGAATTGGGCTAAGAAAGGTGCTCTGATTGGTGTTACAGGTCGCATTCAGACTCGT
AGCTATGACAATCAACAAGGGCAACGTGTCTACGTTACTGAGGTAGTTGCAGAAAGTTTCCAACTCTTGGAAAGTCGTGG
ACAACAGTCGAATTCTCAAGACGGATCATTTGGAAATTCAAGTCCTATGGATATCCAAGACGAAGATTTGCCGTTCTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.907 |
100 |
0.689 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.674 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
49.242 |
100 |
0.492 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.212 |
100 |
0.462 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.455 |
100 |
0.455 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.455 |
100 |
0.455 |
| ssbA | Streptococcus mutans UA159 |
44.697 |
100 |
0.447 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.128 |
82.576 |
0.447 |
| ssb | Vibrio cholerae strain A1552 |
29.48 |
100 |
0.386 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
48.113 |
80.303 |
0.386 |