Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | MTX75_RS07495 | Genome accession | NZ_CP094857 |
| Coordinates | 1562333..1562644 (-) | Length | 103 a.a. |
| NCBI ID | WP_000472256.1 | Uniprot ID | A0A0H2XGS7 |
| Organism | Staphylococcus aureus strain ATCC 29213 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 1557333..1567644
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MTX75_RS07460 (MTX75_07460) | gcvPA | 1557835..1559181 (-) | 1347 | WP_000019691.1 | aminomethyl-transferring glycine dehydrogenase subunit GcvPA | - |
| MTX75_RS07465 (MTX75_07465) | gcvT | 1559201..1560292 (-) | 1092 | WP_000093349.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| MTX75_RS07470 (MTX75_07470) | - | 1560451..1560975 (-) | 525 | WP_001015120.1 | shikimate kinase | - |
| MTX75_RS07475 (MTX75_07475) | - | 1560965..1561111 (-) | 147 | WP_001792109.1 | hypothetical protein | - |
| MTX75_RS07480 (MTX75_07480) | comGF | 1561208..1561705 (-) | 498 | WP_001788897.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| MTX75_RS07485 (MTX75_07485) | comGE | 1561623..1561922 (-) | 300 | WP_000844410.1 | hypothetical protein | Machinery gene |
| MTX75_RS07490 (MTX75_07490) | comGD | 1561909..1562355 (-) | 447 | WP_001788899.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| MTX75_RS07495 (MTX75_07495) | comGC | 1562333..1562644 (-) | 312 | WP_000472256.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| MTX75_RS07500 (MTX75_07500) | comGB | 1562658..1563728 (-) | 1071 | WP_000776422.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| MTX75_RS07505 (MTX75_07505) | comGA | 1563700..1564674 (-) | 975 | WP_000697220.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| MTX75_RS07510 (MTX75_07510) | - | 1564726..1565349 (-) | 624 | WP_001223008.1 | MBL fold metallo-hydrolase | - |
| MTX75_RS07515 (MTX75_07515) | - | 1565346..1565675 (-) | 330 | WP_001018871.1 | MTH1187 family thiamine-binding protein | - |
| MTX75_RS07520 (MTX75_07520) | - | 1565675..1566661 (-) | 987 | WP_000161314.1 | ROK family glucokinase | - |
| MTX75_RS07525 (MTX75_07525) | - | 1566658..1566861 (-) | 204 | WP_000087561.1 | YqgQ family protein | - |
Sequence
Protein
Download Length: 103 a.a. Molecular weight: 11315.36 Da Isoelectric Point: 8.5268
>NTDB_id=580933 MTX75_RS07495 WP_000472256.1 1562333..1562644(-) (comGC) [Staphylococcus aureus strain ATCC 29213]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN
Nucleotide
Download Length: 312 bp
>NTDB_id=580933 MTX75_RS07495 WP_000472256.1 1562333..1562644(-) (comGC) [Staphylococcus aureus strain ATCC 29213]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Staphylococcus aureus MW2 |
100 |
100 |
1 |
| comGC | Staphylococcus aureus N315 |
100 |
100 |
1 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae D39 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus pneumoniae R6 |
46.078 |
99.029 |
0.456 |
| comGC/cglC | Streptococcus mitis SK321 |
51.163 |
83.495 |
0.427 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
51.163 |
83.495 |
0.427 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
42.857 |
95.146 |
0.408 |
| comGC | Streptococcus suis isolate S10 |
50 |
75.728 |
0.379 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
41.758 |
88.35 |
0.369 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
46.341 |
79.612 |
0.369 |