Detailed information NTG0577596

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: KQ224_RS07620
• Genome accession: NZ_CP076721
• Coordinates: 1458714..1458992 (+)
• Length: 92 a.a.
• NCBI ID: WP_216806337.1
• Uniprot ID: -
• Organism: Streptococcus parasuis strain H35
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1453714..1463992

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KQ224_RS07600 (KQ224_07600)	-	1455374..1455742 (+)	369	WP_171989702.1	DUF1033 family protein	-
KQ224_RS07605 (KQ224_07605)	-	1455775..1456725 (-)	951	WP_216806334.1	S66 peptidase family protein	-
KQ224_RS07610 (KQ224_07610)	comYA	1456813..1457763 (+)	951	WP_216806335.1	competence type IV pilus ATPase ComGA	Machinery gene
KQ224_RS07615 (KQ224_07615)	comYB	1457675..1458712 (+)	1038	WP_216806336.1	competence type IV pilus assembly protein ComGB	Machinery gene
KQ224_RS07620 (KQ224_07620)	comYC	1458714..1458992 (+)	279	WP_216806337.1	competence type IV pilus major pilin ComGC	Machinery gene
KQ224_RS07625 (KQ224_07625)	comGD	1458982..1459386 (+)	405	WP_216806338.1	competence type IV pilus minor pilin ComGD	-
KQ224_RS07630 (KQ224_07630)	comGE	1459358..1459651 (+)	294	WP_105126461.1	competence type IV pilus minor pilin ComGE	-
KQ224_RS07635 (KQ224_07635)	comYF	1459638..1460072 (+)	435	WP_216806339.1	competence type IV pilus minor pilin ComGF	Machinery gene
KQ224_RS07640 (KQ224_07640)	comGG	1460050..1460550 (+)	501	WP_216806340.1	competence type IV pilus minor pilin ComGG	-
KQ224_RS07645 (KQ224_07645)	comYH	1460570..1461523 (+)	954	WP_024392669.1	class I SAM-dependent methyltransferase	Machinery gene
KQ224_RS07650 (KQ224_07650)	-	1461573..1462760 (+)	1188	WP_216806341.1	acetate kinase	-
KQ224_RS07655 (KQ224_07655)	-	1463015..1463566 (+)	552	WP_216806342.1	folate family ECF transporter S component	-

Sequence

Protein

• Length: 92 a.a.
• Molecular weight: 10543.61 Da
• Isoelectric Point: 8.4453

>NTDB_id=577596 KQ224_RS07620 WP_216806337.1 1458714..1458992(+) (comYC) [Streptococcus parasuis strain H35]
MKKMLKKKVKGFTLIEMLVVLGIISILLLLFVPNLSNQKEVIQKKGDAAIVKIVESQMDIYELDHGVRPTAEELYNQQMI
TIDQLEKYNNVP

Nucleotide

• Length: 279 bp

>NTDB_id=577596 KQ224_RS07620 WP_216806337.1 1458714..1458992(+) (comYC) [Streptococcus parasuis strain H35]
ATGAAAAAAATGTTGAAAAAGAAAGTCAAAGGTTTCACTTTGATCGAAATGTTAGTGGTACTTGGAATTATTAGTATTCT
CTTGCTATTATTTGTGCCAAATCTCAGTAATCAAAAAGAAGTAATTCAGAAGAAAGGGGACGCAGCAATTGTAAAAATTG
TTGAAAGTCAAATGGACATTTACGAATTGGACCATGGTGTTCGCCCAACAGCGGAAGAATTATATAATCAGCAGATGATA
ACAATAGATCAACTAGAAAAATATAATAATGTACCTTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus suis isolate S10	62.637	98.913	0.62
comGC/cglC	Streptococcus mitis SK321	54.839	100	0.554
comGC	Lactococcus lactis subsp. cremoris KW2	55.556	97.826	0.543
comGC/cglC	Streptococcus mitis NCTC 12261	54.348	100	0.543
comGC/cglC	Streptococcus pneumoniae R6	52.174	100	0.522
comGC/cglC	Streptococcus pneumoniae Rx1	52.174	100	0.522
comGC/cglC	Streptococcus pneumoniae TIGR4	52.174	100	0.522
comGC/cglC	Streptococcus pneumoniae D39	52.174	100	0.522
comYC	Streptococcus mutans UA140	51.111	97.826	0.5
comYC	Streptococcus mutans UA159	51.111	97.826	0.5
comYC	Streptococcus gordonii str. Challis substr. CH1	51.685	96.739	0.5
comGC	Latilactobacillus sakei subsp. sakei 23K	44.578	90.217	0.402
comGC	Bacillus subtilis subsp. subtilis str. 168	46.667	81.522	0.38