Detailed information NTG0569578

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: KIW23_RS10430
• Genome accession: NZ_CP075561
• Coordinates: 2120423..2120737 (-)
• Length: 104 a.a.
• NCBI ID: WP_070787377.1
• Uniprot ID: A0A9Q5JH30
• Organism: Floricoccus penangensis strain ML061-4
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2115423..2125737

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
KIW23_RS10390 (KIW23_10405)	-	2115624..2116436 (-)	813	WP_420828205.1	metal ABC transporter permease	-
KIW23_RS10395 (KIW23_10410)	-	2116436..2117143 (-)	708	WP_251314853.1	metal ABC transporter ATP-binding protein	-
KIW23_RS10400 (KIW23_10415)	-	2117144..2118079 (-)	936	WP_251314854.1	metal ABC transporter substrate-binding protein	-
KIW23_RS10405 (KIW23_10420)	ispE	2118158..2119006 (-)	849	WP_251314855.1	4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase	-
KIW23_RS10410 (KIW23_10425)	comGG	2119032..2119340 (-)	309	WP_251314856.1	competence type IV pilus minor pilin ComGG	-
KIW23_RS10415 (KIW23_10430)	comGF	2119340..2119777 (-)	438	WP_251314857.1	competence type IV pilus minor pilin ComGF	-
KIW23_RS10420 (KIW23_10435)	comGE	2119764..2120057 (-)	294	WP_251314858.1	competence type IV pilus minor pilin ComGE	-
KIW23_RS10425 (KIW23_10440)	comGD	2120029..2120463 (-)	435	WP_083312879.1	competence type IV pilus minor pilin ComGD	-
KIW23_RS10430 (KIW23_10445)	comYC	2120423..2120737 (-)	315	WP_070787377.1	competence type IV pilus major pilin ComGC	Machinery gene
KIW23_RS10435 (KIW23_10450)	comYB	2120734..2121777 (-)	1044	WP_251314860.1	competence type IV pilus assembly protein ComGB	Machinery gene
KIW23_RS10440 (KIW23_10455)	comGA/cglA/cilD	2121701..2122639 (-)	939	WP_251314861.1	competence type IV pilus ATPase ComGA	Machinery gene
KIW23_RS10445 (KIW23_10460)	-	2122728..2123120 (-)	393	WP_233278814.1	DUF1033 family protein	-
KIW23_RS10450 (KIW23_10465)	-	2123203..2123643 (-)	441	WP_251314862.1	CoA-binding protein	-

Sequence

Protein

• Length: 104 a.a.
• Molecular weight: 11882.99 Da
• Isoelectric Point: 10.0731

>NTDB_id=569578 KIW23_RS10430 WP_070787377.1 2120423..2120737(-) (comYC) [Floricoccus penangensis strain ML061-4]
MRKILRKRLPAFTLIEMLIVLLIISVLILLFVPNLSKQKEKINETGQGAVVKVVESQAELFELNNGKSASLKELLADNSI
TQEQYKTYKEYYEKNSNKTAKIPN

Nucleotide

• Length: 315 bp

>NTDB_id=569578 KIW23_RS10430 WP_070787377.1 2120423..2120737(-) (comYC) [Floricoccus penangensis strain ML061-4]
ATGAGAAAAATCTTAAGAAAACGTCTACCAGCCTTTACTTTAATTGAAATGTTAATCGTCCTTCTTATAATCAGTGTTTT
GATTTTATTATTTGTACCAAATTTATCTAAACAAAAAGAAAAAATAAATGAAACCGGCCAAGGAGCAGTAGTAAAAGTTG
TGGAGAGCCAAGCGGAGTTATTTGAGCTAAATAATGGAAAATCAGCTAGTTTAAAAGAATTACTAGCAGATAACAGTATC
ACACAGGAACAGTATAAGACTTATAAGGAATACTATGAAAAAAATTCAAATAAGACAGCTAAGATTCCGAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	62.5	100	0.625
comYC	Streptococcus mutans UA159	62.5	100	0.625
comYC	Streptococcus gordonii str. Challis substr. CH1	59.048	100	0.596
comGC/cglC	Streptococcus mitis NCTC 12261	58.654	100	0.587
comGC/cglC	Streptococcus pneumoniae TIGR4	56.481	100	0.587
comGC/cglC	Streptococcus pneumoniae D39	56.481	100	0.587
comGC/cglC	Streptococcus pneumoniae Rx1	56.481	100	0.587
comGC/cglC	Streptococcus mitis SK321	56.481	100	0.587
comGC/cglC	Streptococcus pneumoniae R6	56.481	100	0.587
comGC	Lactococcus lactis subsp. cremoris KW2	57.732	93.269	0.538
comYC	Streptococcus suis isolate S10	53.409	84.615	0.452
comGC	Staphylococcus aureus MW2	50	80.769	0.404
comGC	Staphylococcus aureus N315	50	80.769	0.404