Detailed information NTG0553420

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: J7U05_RS08580
• Genome accession: NZ_CP072443
• Coordinates: 1656228..1656554 (-)
• Length: 108 a.a.
• NCBI ID: WP_014727724.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain S24724
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1651228..1661554

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7U05_RS08540	-	1651495..1651833 (-)	339	WP_372432830.1	lysostaphin resistance A-like protein	-
J7U05_RS08545 (J7U05_08510)	-	1652163..1652360 (-)	198	WP_002885716.1	helix-turn-helix transcriptional regulator	-
J7U05_RS08550 (J7U05_08515)	-	1652609..1653802 (-)	1194	WP_014608740.1	acetate kinase	-
J7U05_RS08555 (J7U05_08520)	comYH	1653858..1654814 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
J7U05_RS08560 (J7U05_08525)	comGG	1654859..1655176 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
J7U05_RS08565 (J7U05_08530)	comYF	1655154..1655591 (-)	438	WP_014608742.1	competence type IV pilus minor pilin ComGF	Machinery gene
J7U05_RS08570 (J7U05_08535)	comGE	1655575..1655868 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
J7U05_RS08575 (J7U05_08540)	comYD	1655840..1656268 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
J7U05_RS08580 (J7U05_08545)	comYC	1656228..1656554 (-)	327	WP_014727724.1	competence type IV pilus major pilin ComGC	Machinery gene
J7U05_RS08585 (J7U05_08550)	comYB	1656551..1657651 (-)	1101	WP_116920398.1	competence type IV pilus assembly protein ComGB	Machinery gene
J7U05_RS08590 (J7U05_08555)	comGA/cglA/cilD	1657533..1658474 (-)	942	WP_014727726.1	competence type IV pilus ATPase ComGA	Machinery gene
J7U05_RS08595 (J7U05_08560)	-	1658555..1658917 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11998.11 Da
• Isoelectric Point: 9.6951

>NTDB_id=553420 J7U05_RS08580 WP_014727724.1 1656228..1656554(-) (comYC) [Streptococcus thermophilus strain S24724]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLEALVL
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=553420 J7U05_RS08580 WP_014727724.1 1656228..1656554(-) (comYC) [Streptococcus thermophilus strain S24724]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGAAGCTCTTGTTTTA
GAAGGTCAAATTACTCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	55.66	98.148	0.546
comYC	Streptococcus suis isolate S10	59.091	81.481	0.481
comGC	Staphylococcus aureus MW2	51.282	72.222	0.37
comGC	Staphylococcus aureus N315	51.282	72.222	0.37