Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | J4Q32_RS09930 | Genome accession | NZ_CP071916 |
| Coordinates | 1911039..1911305 (-) | Length | 88 a.a. |
| NCBI ID | WP_000962026.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 19A-19087 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1911796..1958995 | 1911039..1911305 | flank | 491 |
Gene organization within MGE regions
Location: 1911039..1958995
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J4Q32_RS09930 (J4Q32_09920) | comGC/cglC | 1911039..1911305 (-) | 267 | WP_000962026.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| J4Q32_RS09935 (J4Q32_09925) | - | 1911307..1911564 (-) | 258 | WP_000698513.1 | hypothetical protein | - |
| J4Q32_RS09940 (J4Q32_09930) | - | 1911796..1912752 (-) | 957 | WP_233923013.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| J4Q32_RS09945 (J4Q32_09935) | - | 1912755..1913090 (-) | 336 | WP_050200954.1 | phage holin | - |
| J4Q32_RS09950 (J4Q32_09940) | - | 1913094..1913510 (-) | 417 | WP_001165344.1 | phage holin family protein | - |
| J4Q32_RS09955 (J4Q32_09945) | - | 1913520..1913870 (-) | 351 | WP_050200952.1 | hypothetical protein | - |
| J4Q32_RS09960 (J4Q32_09950) | - | 1913873..1914076 (-) | 204 | WP_001091109.1 | hypothetical protein | - |
| J4Q32_RS11515 | - | 1914057..1914173 (-) | 117 | WP_001063633.1 | hypothetical protein | - |
| J4Q32_RS09965 | - | 1914170..1923124 (-) | 8955 | WP_233922963.1 | tail fiber domain-containing protein | - |
| J4Q32_RS09970 (J4Q32_09970) | - | 1923129..1923479 (-) | 351 | WP_000068025.1 | DUF6711 family protein | - |
| J4Q32_RS09975 (J4Q32_09975) | - | 1923488..1927141 (-) | 3654 | WP_233922964.1 | hypothetical protein | - |
| J4Q32_RS09980 (J4Q32_09980) | - | 1927128..1927478 (-) | 351 | WP_000478016.1 | hypothetical protein | - |
| J4Q32_RS09985 (J4Q32_09985) | - | 1927517..1927897 (-) | 381 | WP_001185632.1 | DUF6096 family protein | - |
| J4Q32_RS09990 (J4Q32_09990) | - | 1927902..1928315 (-) | 414 | WP_000880676.1 | phage tail tube protein | - |
| J4Q32_RS09995 (J4Q32_09995) | - | 1928318..1928686 (-) | 369 | WP_000608235.1 | hypothetical protein | - |
| J4Q32_RS10000 (J4Q32_10000) | - | 1928683..1929198 (-) | 516 | WP_044812726.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| J4Q32_RS10005 (J4Q32_10005) | - | 1929173..1929511 (-) | 339 | WP_000478943.1 | hypothetical protein | - |
| J4Q32_RS10010 (J4Q32_10010) | - | 1929492..1929803 (-) | 312 | WP_000021221.1 | phage head-tail connector protein | - |
| J4Q32_RS10015 (J4Q32_10015) | - | 1929805..1929993 (-) | 189 | WP_000669348.1 | hypothetical protein | - |
| J4Q32_RS10020 (J4Q32_10020) | - | 1929983..1930165 (-) | 183 | WP_000054934.1 | Rho termination factor N-terminal domain-containing protein | - |
| J4Q32_RS10025 (J4Q32_10025) | - | 1930177..1931022 (-) | 846 | WP_000123890.1 | N4-gp56 family major capsid protein | - |
| J4Q32_RS10030 (J4Q32_10030) | - | 1931029..1931613 (-) | 585 | WP_001288026.1 | DUF4355 domain-containing protein | - |
| J4Q32_RS10035 (J4Q32_10035) | - | 1931830..1932081 (-) | 252 | WP_000890163.1 | DUF6275 family protein | - |
| J4Q32_RS10040 (J4Q32_10040) | - | 1932083..1932328 (-) | 246 | WP_050221455.1 | hypothetical protein | - |
| J4Q32_RS10045 (J4Q32_10045) | - | 1932380..1932607 (-) | 228 | WP_050110656.1 | hypothetical protein | - |
| J4Q32_RS10050 (J4Q32_10050) | - | 1932595..1933998 (-) | 1404 | WP_225791470.1 | minor capsid protein | - |
| J4Q32_RS10055 (J4Q32_10055) | - | 1933907..1935376 (-) | 1470 | WP_078730733.1 | phage portal protein | - |
| J4Q32_RS10060 (J4Q32_10060) | - | 1935388..1936686 (-) | 1299 | WP_000084426.1 | PBSX family phage terminase large subunit | - |
| J4Q32_RS10065 (J4Q32_10065) | - | 1936664..1937104 (-) | 441 | WP_001859583.1 | terminase small subunit | - |
| J4Q32_RS10075 (J4Q32_10075) | - | 1937578..1938000 (-) | 423 | WP_001030244.1 | DUF1492 domain-containing protein | - |
| J4Q32_RS10080 (J4Q32_10080) | - | 1938070..1938435 (-) | 366 | WP_000802874.1 | hypothetical protein | - |
| J4Q32_RS10085 (J4Q32_10085) | - | 1938432..1938752 (-) | 321 | WP_320408135.1 | 3-dehydroquinate synthase | - |
| J4Q32_RS10090 (J4Q32_10090) | - | 1939008..1939187 (-) | 180 | WP_001042650.1 | hypothetical protein | - |
| J4Q32_RS10095 (J4Q32_10095) | - | 1939180..1939674 (-) | 495 | WP_233922966.1 | YopX family protein | - |
| J4Q32_RS10100 (J4Q32_10100) | - | 1939671..1940189 (-) | 519 | WP_233922967.1 | DUF1642 domain-containing protein | - |
| J4Q32_RS10105 (J4Q32_10105) | - | 1940191..1940508 (-) | 318 | WP_174222359.1 | hypothetical protein | - |
| J4Q32_RS10110 (J4Q32_10110) | - | 1940533..1940715 (-) | 183 | WP_000796349.1 | hypothetical protein | - |
| J4Q32_RS10115 (J4Q32_10115) | - | 1940731..1941162 (-) | 432 | WP_000779143.1 | RusA family crossover junction endodeoxyribonuclease | - |
| J4Q32_RS10120 (J4Q32_10120) | - | 1941159..1941488 (-) | 330 | WP_050210841.1 | hypothetical protein | - |
| J4Q32_RS10125 (J4Q32_10125) | - | 1941502..1941711 (-) | 210 | WP_000455269.1 | hypothetical protein | - |
| J4Q32_RS10130 (J4Q32_10130) | - | 1941713..1942408 (-) | 696 | WP_050099130.1 | site-specific DNA-methyltransferase | - |
| J4Q32_RS10135 (J4Q32_10135) | ssbA | 1942421..1942837 (-) | 417 | WP_050201984.1 | single-stranded DNA-binding protein | Machinery gene |
| J4Q32_RS10140 (J4Q32_10140) | - | 1942827..1942970 (-) | 144 | WP_153277088.1 | hypothetical protein | - |
| J4Q32_RS10145 (J4Q32_10145) | - | 1942973..1944037 (-) | 1065 | WP_233922968.1 | DUF1351 domain-containing protein | - |
| J4Q32_RS10150 (J4Q32_10150) | bet | 1944047..1944799 (-) | 753 | WP_050263779.1 | phage recombination protein Bet | - |
| J4Q32_RS10155 (J4Q32_10155) | - | 1944817..1945002 (-) | 186 | WP_000746960.1 | hypothetical protein | - |
| J4Q32_RS10160 (J4Q32_10160) | - | 1945171..1945314 (-) | 144 | WP_001862963.1 | hypothetical protein | - |
| J4Q32_RS10165 (J4Q32_10165) | - | 1945301..1945561 (-) | 261 | WP_000471463.1 | hypothetical protein | - |
| J4Q32_RS10170 (J4Q32_10170) | - | 1945574..1945828 (-) | 255 | WP_000275521.1 | hypothetical protein | - |
| J4Q32_RS10175 (J4Q32_10175) | - | 1945829..1946050 (-) | 222 | WP_001864263.1 | hypothetical protein | - |
| J4Q32_RS10180 (J4Q32_10180) | - | 1946050..1946211 (-) | 162 | WP_000823399.1 | BOW99_gp33 family protein | - |
| J4Q32_RS10185 (J4Q32_10185) | - | 1946276..1946419 (-) | 144 | WP_001862958.1 | hypothetical protein | - |
| J4Q32_RS10190 (J4Q32_10190) | - | 1946536..1946760 (+) | 225 | WP_000517704.1 | DUF2188 domain-containing protein | - |
| J4Q32_RS10195 (J4Q32_10195) | - | 1946757..1946939 (-) | 183 | WP_001247797.1 | hypothetical protein | - |
| J4Q32_RS10200 (J4Q32_10200) | - | 1947121..1947399 (-) | 279 | WP_000261154.1 | HTH domain-containing protein | - |
| J4Q32_RS10205 (J4Q32_10205) | - | 1947566..1947802 (-) | 237 | WP_001157069.1 | hypothetical protein | - |
| J4Q32_RS11360 | - | 1947876..1948001 (+) | 126 | WP_257885839.1 | hypothetical protein | - |
| J4Q32_RS10210 (J4Q32_10215) | - | 1947994..1948293 (-) | 300 | WP_191855094.1 | hypothetical protein | - |
| J4Q32_RS10215 (J4Q32_10220) | - | 1948368..1948643 (-) | 276 | WP_050202804.1 | hypothetical protein | - |
| J4Q32_RS10220 (J4Q32_10225) | - | 1948804..1949556 (+) | 753 | WP_233922969.1 | XRE family transcriptional regulator | - |
| J4Q32_RS10225 (J4Q32_10230) | - | 1949558..1950322 (+) | 765 | WP_219576745.1 | hypothetical protein | - |
| J4Q32_RS10230 (J4Q32_10235) | - | 1950629..1952074 (+) | 1446 | WP_219576746.1 | recombinase family protein | - |
| J4Q32_RS10240 (J4Q32_10245) | comGB/cglB | 1952156..1953172 (-) | 1017 | WP_013193332.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| J4Q32_RS10245 (J4Q32_10250) | comGA/cglA/cilD | 1953120..1954061 (-) | 942 | WP_000249567.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| J4Q32_RS10250 (J4Q32_10255) | - | 1954137..1954502 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| J4Q32_RS10255 (J4Q32_10260) | - | 1954653..1955711 (-) | 1059 | WP_000649468.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| J4Q32_RS10260 (J4Q32_10265) | nagA | 1955874..1957025 (-) | 1152 | WP_001134457.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| J4Q32_RS10265 (J4Q32_10270) | - | 1957178..1958995 (-) | 1818 | WP_001220865.1 | acyltransferase family protein | - |
Sequence
Protein
Download Length: 88 a.a. Molecular weight: 9818.31 Da Isoelectric Point: 7.0116
>NTDB_id=548980 J4Q32_RS09930 WP_000962026.1 1911039..1911305(-) (comGC/cglC) [Streptococcus pneumoniae strain 19A-19087]
MLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLQADGRITEEQAKAYKEYHDKNG
VANRKVND
MLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLEKNEDASLSKLQADGRITEEQAKAYKEYHDKNG
VANRKVND
Nucleotide
Download Length: 267 bp
>NTDB_id=548980 J4Q32_RS09930 WP_000962026.1 1911039..1911305(-) (comGC/cglC) [Streptococcus pneumoniae strain 19A-19087]
ATGTTGGTGGTCTTGCTGATTATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAGGCAGTCAA
TGACAAAGGAAAAGCAGCTGTTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTA
GCCTAAGCAAGTTACAAGCAGATGGGCGAATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACCATGATAAAAATGGA
GTAGCAAATCGTAAAGTCAATGATTAA
ATGTTGGTGGTCTTGCTGATTATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAGGCAGTCAA
TGACAAAGGAAAAGCAGCTGTTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGAAAAGAATGAAGATGCTA
GCCTAAGCAAGTTACAAGCAGATGGGCGAATCACGGAAGAACAGGCTAAAGCTTATAAAGAATACCATGATAAAAATGGA
GTAGCAAATCGTAAAGTCAATGATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
97.727 |
100 |
0.977 |
| comGC/cglC | Streptococcus pneumoniae D39 |
97.727 |
100 |
0.977 |
| comGC/cglC | Streptococcus pneumoniae R6 |
97.727 |
100 |
0.977 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
96.591 |
100 |
0.966 |
| comGC/cglC | Streptococcus mitis SK321 |
93.243 |
84.091 |
0.784 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
91.176 |
77.273 |
0.705 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
72.5 |
90.909 |
0.659 |
| comYC | Streptococcus suis isolate S10 |
68.056 |
81.818 |
0.557 |
| comYC | Streptococcus mutans UA140 |
61.429 |
79.545 |
0.489 |
| comYC | Streptococcus mutans UA159 |
61.429 |
79.545 |
0.489 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
50.667 |
85.227 |
0.432 |
| comGC | Staphylococcus aureus MW2 |
47.826 |
78.409 |
0.375 |
| comGC | Staphylococcus aureus N315 |
47.826 |
78.409 |
0.375 |