Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   LRO88_RS13730 Genome accession   NZ_CP089148
Coordinates   2516644..2516817 (+) Length   57 a.a.
NCBI ID   WP_014477323.1    Uniprot ID   -
Organism   Bacillus subtilis strain NIB353     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2511644..2521817
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LRO88_RS13715 gcvT 2512442..2513530 (-) 1089 WP_038829737.1 glycine cleavage system aminomethyltransferase GcvT -
  LRO88_RS13720 hepAA 2513972..2515645 (+) 1674 WP_038829735.1 DEAD/DEAH box helicase -
  LRO88_RS13725 yqhG 2515666..2516460 (+) 795 WP_231833925.1 YqhG family protein -
  LRO88_RS13730 sinI 2516644..2516817 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  LRO88_RS13735 sinR 2516851..2517186 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  LRO88_RS13740 tasA 2517278..2518063 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  LRO88_RS13745 sipW 2518128..2518700 (-) 573 WP_003246088.1 signal peptidase I SipW -
  LRO88_RS13750 tapA 2518684..2519445 (-) 762 WP_064671037.1 amyloid fiber anchoring/assembly protein TapA -
  LRO88_RS13755 yqzG 2519716..2520042 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  LRO88_RS13760 spoIITA 2520084..2520263 (-) 180 WP_014480252.1 YqzE family protein -
  LRO88_RS13765 comGG 2520335..2520709 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  LRO88_RS13770 comGF 2520710..2521093 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  LRO88_RS13775 comGE 2521119..2521466 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6633.58 Da        Isoelectric Point: 6.7231

>NTDB_id=548978 LRO88_RS13730 WP_014477323.1 2516644..2516817(+) (sinI) [Bacillus subtilis strain NIB353]
MKNAKQEHFELDQEWVELMMEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=548978 LRO88_RS13730 WP_014477323.1 2516644..2516817(+) (sinI) [Bacillus subtilis strain NIB353]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTGATGATGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

98.246

100

0.982