Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   LRO88_RS13770 Genome accession   NZ_CP089148
Coordinates   2520710..2521093 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   -
Organism   Bacillus subtilis strain NIB353     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2515710..2526093
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LRO88_RS13730 sinI 2516644..2516817 (+) 174 WP_014477323.1 anti-repressor SinI Regulator
  LRO88_RS13735 sinR 2516851..2517186 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  LRO88_RS13740 tasA 2517278..2518063 (-) 786 WP_014477324.1 biofilm matrix protein TasA -
  LRO88_RS13745 sipW 2518128..2518700 (-) 573 WP_003246088.1 signal peptidase I SipW -
  LRO88_RS13750 tapA 2518684..2519445 (-) 762 WP_064671037.1 amyloid fiber anchoring/assembly protein TapA -
  LRO88_RS13755 yqzG 2519716..2520042 (+) 327 WP_021480018.1 YqzG/YhdC family protein -
  LRO88_RS13760 spoIITA 2520084..2520263 (-) 180 WP_014480252.1 YqzE family protein -
  LRO88_RS13765 comGG 2520335..2520709 (-) 375 WP_064671036.1 ComG operon protein ComGG Machinery gene
  LRO88_RS13770 comGF 2520710..2521093 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  LRO88_RS13775 comGE 2521119..2521466 (-) 348 WP_063335293.1 ComG operon protein 5 Machinery gene
  LRO88_RS13780 comGD 2521450..2521881 (-) 432 WP_032726159.1 competence type IV pilus minor pilin ComGD Machinery gene
  LRO88_RS13785 comGC 2521871..2522167 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  LRO88_RS13790 comGB 2522181..2523218 (-) 1038 WP_086344083.1 comG operon protein ComGB Machinery gene
  LRO88_RS13795 comGA 2523205..2524275 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  LRO88_RS13800 corA 2524679..2525632 (-) 954 WP_015483432.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=548981 LRO88_RS13770 WP_032726158.1 2520710..2521093(-) (comGF) [Bacillus subtilis strain NIB353]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=548981 LRO88_RS13770 WP_032726158.1 2520710..2521093(-) (comGF) [Bacillus subtilis strain NIB353]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGATATCCGTTTTGACATTTATCATTCAATGATCAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992