Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   LQT99_RS11710 Genome accession   NZ_CP088005
Coordinates   2440028..2440342 (-) Length   104 a.a.
NCBI ID   WP_032874016.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain bm     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2435028..2445342
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LQT99_RS11665 (LQT99_11650) sinI 2435709..2435882 (+) 174 WP_032874029.1 anti-repressor SinI family protein Regulator
  LQT99_RS11670 (LQT99_11655) sinR 2435916..2436251 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LQT99_RS11675 (LQT99_11660) - 2436299..2437084 (-) 786 WP_032874027.1 TasA family protein -
  LQT99_RS11680 (LQT99_11665) - 2437149..2437733 (-) 585 WP_032874025.1 signal peptidase I -
  LQT99_RS11685 (LQT99_11670) tapA 2437705..2438376 (-) 672 WP_032874023.1 amyloid fiber anchoring/assembly protein TapA -
  LQT99_RS11690 (LQT99_11675) - 2438635..2438964 (+) 330 WP_032874021.1 DUF3889 domain-containing protein -
  LQT99_RS11695 (LQT99_11680) - 2439005..2439184 (-) 180 WP_022552966.1 YqzE family protein -
  LQT99_RS11700 (LQT99_11685) comGG 2439241..2439618 (-) 378 WP_032874019.1 competence type IV pilus minor pilin ComGG Machinery gene
  LQT99_RS11705 (LQT99_11690) comGF 2439619..2440083 (-) 465 WP_223813077.1 competence type IV pilus minor pilin ComGF Machinery gene
  LQT99_RS11710 (LQT99_11695) comGE 2440028..2440342 (-) 315 WP_032874016.1 competence type IV pilus minor pilin ComGE Machinery gene
  LQT99_RS11715 (LQT99_11700) comGD 2440326..2440763 (-) 438 WP_007612572.1 competence type IV pilus minor pilin ComGD Machinery gene
  LQT99_RS11720 (LQT99_11705) comGC 2440753..2441061 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  LQT99_RS11725 (LQT99_11710) comGB 2441066..2442103 (-) 1038 WP_032874014.1 competence type IV pilus assembly protein ComGB Machinery gene
  LQT99_RS11730 (LQT99_11715) comGA 2442090..2443160 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  LQT99_RS11735 (LQT99_11720) - 2443357..2444307 (-) 951 WP_032874012.1 magnesium transporter CorA family protein -

Sequence


Protein


Download         Length: 104 a.a.        Molecular weight: 11902.88 Da        Isoelectric Point: 5.8321

>NTDB_id=547153 LQT99_RS11710 WP_032874016.1 2440028..2440342(-) (comGE) [Bacillus amyloliquefaciens strain bm]
MLNGNKGFSTIETLSAMAIWLFLMTSIIPVWTDMLTDGLKIEDRQEAYQLLQKHISTYMMTGKKPPSPGVKWKEDGEYYK
VCAADRGEKEMCLSILKTDWLYAS

Nucleotide


Download         Length: 315 bp        

>NTDB_id=547153 LQT99_RS11710 WP_032874016.1 2440028..2440342(-) (comGE) [Bacillus amyloliquefaciens strain bm]
ATGCTAAACGGAAATAAGGGGTTCTCTACTATTGAAACACTATCAGCAATGGCCATTTGGCTGTTCCTTATGACGTCTAT
CATTCCGGTCTGGACGGACATGCTGACAGATGGTCTGAAAATAGAAGATCGCCAGGAAGCGTACCAGCTTCTTCAGAAAC
ATATCAGCACTTATATGATGACCGGAAAAAAGCCGCCGTCTCCCGGTGTGAAGTGGAAGGAGGATGGTGAGTATTACAAA
GTGTGTGCGGCTGACCGCGGTGAAAAAGAAATGTGCCTCAGTATTCTCAAAACAGACTGGCTTTACGCTTCTTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

43.478

100

0.481