Detailed information NTG0530279

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LLUC047_RS12255
• Genome accession: NZ_CP068658
• Coordinates: 2342004..2342354 (-)
• Length: 116 a.a.
• NCBI ID: WP_050574401.1
• Uniprot ID: -
• Organism: Lactococcus cremoris strain UC047
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2337004..2347354

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLUC047_RS12215 (LLUC047_11925)	-	2337540..2338349 (-)	810	WP_011677177.1	metal ABC transporter permease	-
LLUC047_RS12220 (LLUC047_11930)	-	2338342..2339079 (-)	738	WP_011677178.1	metal ABC transporter ATP-binding protein	-
LLUC047_RS12225 (LLUC047_11935)	-	2339258..2340100 (-)	843	WP_021216263.1	metal ABC transporter solute-binding protein, Zn/Mn family	-
LLUC047_RS12230 (LLUC047_11940)	-	2340097..2340534 (-)	438	WP_011677180.1	zinc-dependent MarR family transcriptional regulator	-
LLUC047_RS12235 (LLUC047_11945)	comGG	2340614..2340913 (-)	300	WP_011677181.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLUC047_RS12240 (LLUC047_11950)	comGF	2340937..2341362 (-)	426	WP_021216262.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLUC047_RS12245 (LLUC047_11955)	comGE	2341346..2341582 (-)	237	WP_014573335.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLUC047_RS12250 (LLUC047_14310)	comGD	2341614..2341802 (-)	189	WP_014573336.1	hypothetical protein	Machinery gene
LLUC047_RS12255 (LLUC047_11965)	comGC	2342004..2342354 (-)	351	WP_050574401.1	competence type IV pilus major pilin ComGC	Machinery gene
LLUC047_RS12260 (LLUC047_11970)	comGB	2342399..2343424 (-)	1026	WP_050574400.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLUC047_RS12265 (LLUC047_11975)	-	2343324..2344145 (-)	822	Protein_2386	ATPase, T2SS/T4P/T4SS family	-
LLUC047_RS12270 (LLUC047_11980)	-	2344248..2345138 (+)	891	WP_205536422.1	IS982 family transposase	-
LLUC047_RS12275 (LLUC047_11985)	comGA	2345120..2345311 (-)	192	WP_014573341.1	hypothetical protein	Machinery gene

Sequence

Protein

• Length: 116 a.a.
• Molecular weight: 13289.44 Da
• Isoelectric Point: 7.2003

>NTDB_id=530279 LLUC047_RS12255 WP_050574401.1 2342004..2342354(-) (comGC) [Lactococcus cremoris strain UC047]
MSKALSLIKIHGRKLWQKKQKAFTLIEMLIVLAIISILILLFVPNLIKEKAQVQKTGEAAVVKVVESQAQLYELDHDNDK
PNLSELLSAGMITQKQVTAYDDYYDQNKNEQRNFDD

Nucleotide

• Length: 351 bp

>NTDB_id=530279 LLUC047_RS12255 WP_050574401.1 2342004..2342354(-) (comGC) [Lactococcus cremoris strain UC047]
ATGAGCAAAGCTTTGTCATTAATTAAAATTCACGGAAGAAAGCTTTGGCAAAAAAAGCAAAAAGCATTTACCTTGATTGA
GATGTTAATTGTGTTGGCAATTATCAGTATTTTAATTTTGCTTTTTGTGCCAAATTTGATAAAAGAAAAAGCACAAGTTC
AAAAAACTGGTGAAGCAGCAGTAGTTAAAGTAGTTGAAAGTCAGGCACAACTTTATGAGTTGGATCATGATAATGATAAG
CCAAACCTATCAGAACTTTTAAGTGCGGGGATGATTACGCAAAAGCAAGTCACGGCCTATGATGATTACTATGACCAGAA
TAAAAATGAACAGCGCAATTTCGATGATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (18-41)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	98.276	100	0.983
comYC	Streptococcus gordonii str. Challis substr. CH1	58.586	85.345	0.5
comGC/cglC	Streptococcus mitis SK321	55.882	87.931	0.491
comGC/cglC	Streptococcus pneumoniae R6	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae TIGR4	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae Rx1	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae D39	53.922	87.931	0.474
comYC	Streptococcus mutans UA140	59.14	80.172	0.474
comYC	Streptococcus mutans UA159	59.14	80.172	0.474
comGC/cglC	Streptococcus mitis NCTC 12261	55.67	83.621	0.466
comYC	Streptococcus suis isolate S10	56.818	75.862	0.431