Detailed information
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | LLUC047_RS12250 | Genome accession | NZ_CP068658 |
| Coordinates | 2341614..2341802 (-) | Length | 62 a.a. |
| NCBI ID | WP_014573336.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain UC047 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2336473..2340933 | 2341614..2341802 | flank | 681 |
Gene organization within MGE regions
Location: 2336473..2341802
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC047_RS12215 (LLUC047_11925) | - | 2337540..2338349 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLUC047_RS12220 (LLUC047_11930) | - | 2338342..2339079 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLUC047_RS12225 (LLUC047_11935) | - | 2339258..2340100 (-) | 843 | WP_021216263.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLUC047_RS12230 (LLUC047_11940) | - | 2340097..2340534 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLUC047_RS12235 (LLUC047_11945) | comGG | 2340614..2340913 (-) | 300 | WP_011677181.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLUC047_RS12240 (LLUC047_11950) | comGF | 2340937..2341362 (-) | 426 | WP_021216262.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLUC047_RS12245 (LLUC047_11955) | comGE | 2341346..2341582 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLUC047_RS12250 (LLUC047_14310) | comGD | 2341614..2341802 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7336.65 Da Isoelectric Point: 8.3463
>NTDB_id=530278 LLUC047_RS12250 WP_014573336.1 2341614..2341802(-) (comGD) [Lactococcus cremoris strain UC047]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
Nucleotide
Download Length: 189 bp
>NTDB_id=530278 LLUC047_RS12250 WP_014573336.1 2341614..2341802(-) (comGD) [Lactococcus cremoris strain UC047]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
93.548 |
100 |
0.935 |
| comYD | Streptococcus mutans UA140 |
43.396 |
85.484 |
0.371 |
| comYD | Streptococcus mutans UA159 |
43.396 |
85.484 |
0.371 |