Detailed information NTG0530276

Bioinformatically predicted

Overview

• Name: comGF
• Type: Machinery gene
• Locus tag: LLUC047_RS12240
• Genome accession: NZ_CP068658
• Coordinates: 2340937..2341362 (-)
• Length: 141 a.a.
• NCBI ID: WP_021216262.1
• Uniprot ID: A0A896TCW7
• Organism: Lactococcus cremoris strain UC047
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2335937..2346362

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLUC047_RS12215 (LLUC047_11925)	-	2337540..2338349 (-)	810	WP_011677177.1	metal ABC transporter permease	-
LLUC047_RS12220 (LLUC047_11930)	-	2338342..2339079 (-)	738	WP_011677178.1	metal ABC transporter ATP-binding protein	-
LLUC047_RS12225 (LLUC047_11935)	-	2339258..2340100 (-)	843	WP_021216263.1	metal ABC transporter solute-binding protein, Zn/Mn family	-
LLUC047_RS12230 (LLUC047_11940)	-	2340097..2340534 (-)	438	WP_011677180.1	zinc-dependent MarR family transcriptional regulator	-
LLUC047_RS12235 (LLUC047_11945)	comGG	2340614..2340913 (-)	300	WP_011677181.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLUC047_RS12240 (LLUC047_11950)	comGF	2340937..2341362 (-)	426	WP_021216262.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLUC047_RS12245 (LLUC047_11955)	comGE	2341346..2341582 (-)	237	WP_014573335.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLUC047_RS12250 (LLUC047_14310)	comGD	2341614..2341802 (-)	189	WP_014573336.1	hypothetical protein	Machinery gene
LLUC047_RS12255 (LLUC047_11965)	comGC	2342004..2342354 (-)	351	WP_050574401.1	competence type IV pilus major pilin ComGC	Machinery gene
LLUC047_RS12260 (LLUC047_11970)	comGB	2342399..2343424 (-)	1026	WP_050574400.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLUC047_RS12265 (LLUC047_11975)	-	2343324..2344145 (-)	822	Protein_2386	ATPase, T2SS/T4P/T4SS family	-
LLUC047_RS12270 (LLUC047_11980)	-	2344248..2345138 (+)	891	WP_205536422.1	IS982 family transposase	-
LLUC047_RS12275 (LLUC047_11985)	comGA	2345120..2345311 (-)	192	WP_014573341.1	hypothetical protein	Machinery gene

Sequence

Protein

• Length: 141 a.a.
• Molecular weight: 16282.84 Da
• Isoelectric Point: 7.7759

>NTDB_id=530276 LLUC047_RS12240 WP_021216262.1 2340937..2341362(-) (comGF) [Lactococcus cremoris strain UC047]
MKLKIRAFTLLECLVALLAISGSVLVISGLTRMIEEQMKISQNDSRKDWQIFCEQMRSELSGAKLDNVNQNFLYVTKDKK
LRFELVGDDFRKSDDKGQGYQPMLYDLKGAKIQAEENLIKITIDFDNGGERVFIYRFTDTK

Nucleotide

• Length: 426 bp

>NTDB_id=530276 LLUC047_RS12240 WP_021216262.1 2340937..2341362(-) (comGF) [Lactococcus cremoris strain UC047]
TTGAAGCTCAAAATTAGGGCATTTACTTTACTTGAATGTCTCGTAGCACTTTTGGCAATTTCTGGTTCAGTGCTAGTCAT
CTCAGGGCTGACTAGAATGATTGAAGAACAGATGAAAATAAGCCAGAATGATAGTAGGAAAGATTGGCAAATATTTTGTG
AACAAATGCGTTCAGAACTCTCCGGAGCAAAATTAGACAATGTGAATCAAAATTTTTTGTATGTGACCAAAGATAAGAAG
TTACGGTTCGAATTAGTAGGGGATGATTTTCGTAAAAGTGATGATAAAGGGCAAGGATACCAACCGATGCTTTATGATTT
AAAAGGAGCAAAAATTCAGGCAGAAGAAAATTTGATAAAAATAACAATTGATTTTGATAATGGAGGTGAGCGAGTATTTA
TTTATCGATTTACTGATACAAAGTAA

Domains

Predicted by InterProScan.

• Putative Competence protein ComGF (ComGF) (38-130)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF	Lactococcus lactis subsp. cremoris KW2	99.291	100	0.993
comYF	Streptococcus mutans UA140	43.262	100	0.433
comYF	Streptococcus mutans UA159	42.553	100	0.426
comGF/cglF	Streptococcus mitis NCTC 12261	38.462	100	0.39
comGF/cglF	Streptococcus mitis SK321	38.571	99.291	0.383
comGF/cglF	Streptococcus pneumoniae Rx1	37.143	99.291	0.369
comGF/cglF	Streptococcus pneumoniae D39	37.143	99.291	0.369
comGF/cglF	Streptococcus pneumoniae R6	37.143	99.291	0.369
comGF/cglF	Streptococcus pneumoniae TIGR4	37.143	99.291	0.369