Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGA   Type   Machinery gene
Locus tag   LLUC047_RS12275 Genome accession   NZ_CP068658
Coordinates   2345120..2345311 (-) Length   63 a.a.
NCBI ID   WP_014573341.1    Uniprot ID   A0A896TDC6
Organism   Lactococcus cremoris strain UC047     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2340120..2350311
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLUC047_RS12235 (LLUC047_11945) comGG 2340614..2340913 (-) 300 WP_011677181.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLUC047_RS12240 (LLUC047_11950) comGF 2340937..2341362 (-) 426 WP_021216262.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLUC047_RS12245 (LLUC047_11955) comGE 2341346..2341582 (-) 237 WP_014573335.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLUC047_RS12250 (LLUC047_14310) comGD 2341614..2341802 (-) 189 WP_014573336.1 hypothetical protein Machinery gene
  LLUC047_RS12255 (LLUC047_11965) comGC 2342004..2342354 (-) 351 WP_050574401.1 competence type IV pilus major pilin ComGC Machinery gene
  LLUC047_RS12260 (LLUC047_11970) comGB 2342399..2343424 (-) 1026 WP_050574400.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLUC047_RS12265 (LLUC047_11975) - 2343324..2344145 (-) 822 Protein_2386 ATPase, T2SS/T4P/T4SS family -
  LLUC047_RS12270 (LLUC047_11980) - 2344248..2345138 (+) 891 WP_205536422.1 IS982 family transposase -
  LLUC047_RS12275 (LLUC047_11985) comGA 2345120..2345311 (-) 192 WP_014573341.1 hypothetical protein Machinery gene
  LLUC047_RS12280 (LLUC047_11990) - 2345426..2349256 (-) 3831 Protein_2389 PolC-type DNA polymerase III -

Sequence

Protein


Download         Length: 63 a.a.        Molecular weight: 7255.51 Da        Isoelectric Point: 4.3901

>NTDB_id=530281 LLUC047_RS12275 WP_014573341.1 2345120..2345311(-) (comGA) [Lactococcus cremoris strain UC047]
MVQKKAQELIQKAIEMEASDIYLIASGNLYKIYIRQQLGRTLIEELNQEIGLPELLVDYLAMT

Nucleotide


Download         Length: 192 bp        

>NTDB_id=530281 LLUC047_RS12275 WP_014573341.1 2345120..2345311(-) (comGA) [Lactococcus cremoris strain UC047]
ATGGTACAGAAAAAAGCACAAGAACTCATTCAAAAGGCAATTGAGATGGAGGCTTCTGATATTTATTTAATTGCTTCAGG
AAATCTTTATAAGATATATATTCGTCAACAATTAGGGCGAACTTTAATAGAGGAACTTAACCAAGAGATTGGTTTACCCG
AATTGCTAGTTGATTATTTAGCCATGACTTGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGA Lactococcus lactis subsp. cremoris KW2

96.226

84.127

0.81