Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | C9Q_RS06300 | Genome accession | NZ_CP067090 |
| Coordinates | 1226523..1226942 (-) | Length | 139 a.a. |
| NCBI ID | WP_011054759.1 | Uniprot ID | A0A5S4TJJ6 |
| Organism | Streptococcus pyogenes MGAS10870 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1193728..1235239 | 1226523..1226942 | within | 0 |
Gene organization within MGE regions
Location: 1193728..1235239
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C9Q_RS06065 (C9Q_06045) | prx | 1193728..1193910 (-) | 183 | WP_011054726.1 | hypothetical protein | Regulator |
| C9Q_RS06070 | - | 1193975..1194262 (-) | 288 | WP_011106694.1 | hypothetical protein | - |
| C9Q_RS06075 (C9Q_06050) | - | 1194256..1194831 (-) | 576 | WP_011054727.1 | hypothetical protein | - |
| C9Q_RS06080 (C9Q_06055) | spek | 1195307..1196086 (-) | 780 | WP_011054728.1 | streptococcal pyrogenic exotoxin SpeK | - |
| C9Q_RS06085 (C9Q_06060) | - | 1196390..1197256 (-) | 867 | WP_011054729.1 | DUF334 domain-containing protein | - |
| C9Q_RS06090 (C9Q_06065) | - | 1197244..1197768 (-) | 525 | WP_011017840.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| C9Q_RS06095 (C9Q_06070) | - | 1197908..1199110 (-) | 1203 | WP_011054730.1 | glucosaminidase domain-containing protein | - |
| C9Q_RS06100 (C9Q_06075) | - | 1199221..1199406 (-) | 186 | WP_011054731.1 | holin | - |
| C9Q_RS06105 (C9Q_06080) | - | 1199403..1199699 (-) | 297 | WP_011054732.1 | hypothetical protein | - |
| C9Q_RS06110 (C9Q_06085) | - | 1199710..1200321 (-) | 612 | WP_011054733.1 | DUF1366 domain-containing protein | - |
| C9Q_RS06115 (C9Q_06090) | - | 1200324..1200755 (-) | 432 | WP_002987513.1 | DUF1617 family protein | - |
| C9Q_RS06120 (C9Q_06095) | - | 1200767..1202650 (-) | 1884 | WP_011054734.1 | gp58-like family protein | - |
| C9Q_RS06125 (C9Q_06100) | hylP | 1202665..1203678 (-) | 1014 | WP_011054735.1 | hyaluronidase HylP | - |
| C9Q_RS06130 (C9Q_06105) | - | 1203675..1205819 (-) | 2145 | WP_011054736.1 | phage tail spike protein | - |
| C9Q_RS06135 (C9Q_06110) | - | 1205816..1206532 (-) | 717 | WP_011054737.1 | distal tail protein Dit | - |
| C9Q_RS06140 (C9Q_06115) | - | 1206529..1209789 (-) | 3261 | WP_011054738.1 | tape measure protein | - |
| C9Q_RS06145 (C9Q_06120) | - | 1209779..1210360 (-) | 582 | WP_011054739.1 | bacteriophage Gp15 family protein | - |
| C9Q_RS06150 (C9Q_06125) | - | 1210364..1210798 (-) | 435 | WP_011054740.1 | hypothetical protein | - |
| C9Q_RS06155 (C9Q_06130) | - | 1210837..1211322 (-) | 486 | WP_011054741.1 | hypothetical protein | - |
| C9Q_RS06160 (C9Q_06135) | - | 1211322..1211720 (-) | 399 | WP_010922084.1 | minor capsid protein | - |
| C9Q_RS06165 (C9Q_06140) | - | 1211717..1212073 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| C9Q_RS06170 (C9Q_06145) | - | 1212073..1212405 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| C9Q_RS06175 (C9Q_06150) | - | 1212395..1212811 (-) | 417 | WP_011054743.1 | hypothetical protein | - |
| C9Q_RS06180 (C9Q_06155) | - | 1212865..1213683 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| C9Q_RS06185 (C9Q_06160) | - | 1213687..1214301 (-) | 615 | WP_011106689.1 | hypothetical protein | - |
| C9Q_RS06190 (C9Q_06165) | - | 1214427..1214693 (-) | 267 | WP_011054745.1 | hypothetical protein | - |
| C9Q_RS06195 (C9Q_06170) | - | 1214755..1214994 (-) | 240 | WP_002986829.1 | hypothetical protein | - |
| C9Q_RS06200 (C9Q_06175) | - | 1214966..1216444 (-) | 1479 | WP_011054746.1 | phage minor capsid protein | - |
| C9Q_RS06205 (C9Q_06180) | - | 1216449..1217951 (-) | 1503 | WP_002986832.1 | phage portal protein | - |
| C9Q_RS06210 (C9Q_06185) | - | 1217965..1219176 (-) | 1212 | WP_010922074.1 | PBSX family phage terminase large subunit | - |
| C9Q_RS06215 (C9Q_06190) | - | 1219259..1219732 (-) | 474 | WP_011054747.1 | hypothetical protein | - |
| C9Q_RS06220 (C9Q_06195) | - | 1219783..1220160 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| C9Q_RS06225 (C9Q_06200) | - | 1220221..1220697 (-) | 477 | WP_174132581.1 | GNAT family N-acetyltransferase | - |
| C9Q_RS06230 (C9Q_06205) | - | 1220613..1221290 (-) | 678 | WP_002986850.1 | ABC transporter ATP-binding protein | - |
| C9Q_RS06235 (C9Q_06210) | - | 1221269..1221787 (-) | 519 | WP_002986854.1 | ParB N-terminal domain-containing protein | - |
| C9Q_RS06240 (C9Q_06215) | - | 1221868..1222125 (+) | 258 | WP_011054748.1 | hypothetical protein | - |
| C9Q_RS06245 (C9Q_06220) | - | 1222764..1223204 (-) | 441 | WP_011017866.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| C9Q_RS06250 (C9Q_06225) | - | 1223478..1223648 (-) | 171 | WP_164997036.1 | hypothetical protein | - |
| C9Q_RS06255 (C9Q_06230) | - | 1223645..1224151 (-) | 507 | WP_011054751.1 | DUF1642 domain-containing protein | - |
| C9Q_RS06260 (C9Q_06235) | - | 1224148..1224318 (-) | 171 | WP_011054752.1 | hypothetical protein | - |
| C9Q_RS06265 (C9Q_06240) | - | 1224315..1224719 (-) | 405 | WP_011054753.1 | YopX family protein | - |
| C9Q_RS06270 (C9Q_06245) | - | 1224729..1224998 (-) | 270 | WP_011054754.1 | hypothetical protein | - |
| C9Q_RS06275 (C9Q_06250) | - | 1224995..1225279 (-) | 285 | WP_011054755.1 | DUF3310 domain-containing protein | - |
| C9Q_RS06280 (C9Q_06255) | - | 1225273..1225524 (-) | 252 | WP_011054756.1 | hypothetical protein | - |
| C9Q_RS06285 (C9Q_06260) | - | 1225521..1225877 (-) | 357 | WP_011054757.1 | hypothetical protein | - |
| C9Q_RS06290 (C9Q_06265) | - | 1225874..1226314 (-) | 441 | WP_011054758.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C9Q_RS06295 (C9Q_06270) | - | 1226314..1226517 (-) | 204 | WP_011106686.1 | hypothetical protein | - |
| C9Q_RS06300 (C9Q_06275) | ssbA | 1226523..1226942 (-) | 420 | WP_011054759.1 | single-stranded DNA-binding protein | Machinery gene |
| C9Q_RS06305 (C9Q_06280) | - | 1226935..1227609 (-) | 675 | WP_011054760.1 | ERF family protein | - |
| C9Q_RS06310 (C9Q_06285) | - | 1227610..1228092 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| C9Q_RS06315 (C9Q_06290) | - | 1228114..1228368 (-) | 255 | WP_011054761.1 | hypothetical protein | - |
| C9Q_RS06320 (C9Q_06295) | - | 1228379..1228519 (-) | 141 | WP_011284979.1 | hypothetical protein | - |
| C9Q_RS06325 (C9Q_06300) | - | 1228516..1228749 (-) | 234 | WP_011054762.1 | hypothetical protein | - |
| C9Q_RS06330 (C9Q_06305) | - | 1228730..1229143 (-) | 414 | WP_011054763.1 | DnaD domain protein | - |
| C9Q_RS06335 (C9Q_06310) | - | 1229265..1229522 (-) | 258 | WP_011106684.1 | hypothetical protein | - |
| C9Q_RS06340 (C9Q_06315) | - | 1229616..1229801 (-) | 186 | WP_011054765.1 | hypothetical protein | - |
| C9Q_RS06345 (C9Q_06320) | - | 1229830..1230087 (-) | 258 | WP_002988339.1 | hypothetical protein | - |
| C9Q_RS06350 (C9Q_06325) | - | 1230333..1230500 (-) | 168 | WP_002986885.1 | hypothetical protein | - |
| C9Q_RS06355 (C9Q_06330) | - | 1230576..1230776 (+) | 201 | WP_002986887.1 | KTSC domain-containing protein | - |
| C9Q_RS06360 (C9Q_06335) | - | 1230773..1230922 (-) | 150 | WP_002986888.1 | hypothetical protein | - |
| C9Q_RS06365 (C9Q_06340) | - | 1230955..1231683 (-) | 729 | WP_011054767.1 | phage antirepressor KilAC domain-containing protein | - |
| C9Q_RS06370 (C9Q_06345) | - | 1231694..1231885 (-) | 192 | WP_002986891.1 | hypothetical protein | - |
| C9Q_RS06375 (C9Q_06350) | - | 1232681..1233040 (+) | 360 | WP_011054768.1 | helix-turn-helix transcriptional regulator | - |
| C9Q_RS06380 (C9Q_06355) | - | 1233054..1233434 (+) | 381 | WP_002986894.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C9Q_RS06385 (C9Q_06360) | - | 1233445..1233966 (+) | 522 | WP_002986895.1 | hypothetical protein | - |
| C9Q_RS06390 (C9Q_06365) | - | 1234142..1235239 (+) | 1098 | WP_015967409.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15649.29 Da Isoelectric Point: 4.8660
>NTDB_id=524954 C9Q_RS06300 WP_011054759.1 1226523..1226942(-) (ssbA) [Streptococcus pyogenes MGAS10870]
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGVTGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=524954 C9Q_RS06300 WP_011054759.1 1226523..1226942(-) (ssbA) [Streptococcus pyogenes MGAS10870]
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
ATGATTAATAATGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCTTTGATCGGAGTTACGGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.857 |
100 |
0.691 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.882 |
100 |
0.683 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.043 |
100 |
0.46 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.324 |
100 |
0.453 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.604 |
100 |
0.446 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.955 |
79.856 |
0.439 |
| ssbA | Streptococcus mutans UA159 |
41.727 |
100 |
0.417 |
| ssb | Vibrio cholerae strain A1552 |
31.214 |
100 |
0.388 |
| ssb | Glaesserella parasuis strain SC1401 |
28.814 |
100 |
0.367 |