Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | JC285_RS09560 | Genome accession | NZ_CP065924 |
| Coordinates | 2029253..2029690 (-) | Length | 145 a.a. |
| NCBI ID | WP_015728805.1 | Uniprot ID | - |
| Organism | Staphylococcus pseudintermedius strain SP_11304-2A | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1991221..2037586 | 2029253..2029690 | within | 0 |
Gene organization within MGE regions
Location: 1991221..2037586
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JC285_RS09300 (JC285_09300) | - | 1991221..1992051 (-) | 831 | WP_063284813.1 | sulfite exporter TauE/SafE family protein | - |
| JC285_RS09305 (JC285_09305) | - | 1992060..1992908 (-) | 849 | WP_014614438.1 | DUF72 domain-containing protein | - |
| JC285_RS09310 (JC285_09310) | - | 1993032..1993739 (+) | 708 | WP_037543560.1 | alpha/beta hydrolase | - |
| JC285_RS12625 | - | 1993772..1993894 (-) | 123 | WP_014614440.1 | hypothetical protein | - |
| JC285_RS12505 | - | 1994201..1994545 (-) | 345 | WP_233275645.1 | nitronate monooxygenase | - |
| JC285_RS12510 | - | 1994558..1994722 (-) | 165 | WP_180920909.1 | hypothetical protein | - |
| JC285_RS09320 (JC285_09320) | - | 1994802..1995800 (-) | 999 | WP_014614441.1 | CNNM domain-containing protein | - |
| JC285_RS09325 (JC285_09325) | - | 1996090..1996374 (-) | 285 | WP_100002513.1 | protease | - |
| JC285_RS12515 | - | 1996725..1996940 (-) | 216 | WP_015728850.1 | hypothetical protein | - |
| JC285_RS09335 (JC285_09335) | - | 1997065..1997379 (-) | 315 | WP_100002509.1 | DUF3467 domain-containing protein | - |
| JC285_RS09340 (JC285_09340) | - | 1997607..1998362 (-) | 756 | WP_198462505.1 | CHAP domain-containing protein | - |
| JC285_RS09345 (JC285_09345) | - | 1998375..1998629 (-) | 255 | WP_060830201.1 | phage holin | - |
| JC285_RS09350 (JC285_09350) | - | 1998647..2000536 (-) | 1890 | WP_198462506.1 | glucosaminidase domain-containing protein | - |
| JC285_RS09355 (JC285_09355) | - | 2000659..2001033 (-) | 375 | WP_015728845.1 | hypothetical protein | - |
| JC285_RS09360 (JC285_09360) | - | 2001066..2002337 (-) | 1272 | WP_015728844.1 | phage baseplate upper protein | - |
| JC285_RS09365 (JC285_09365) | - | 2002354..2003397 (-) | 1044 | WP_015728843.1 | SGNH/GDSL hydrolase family protein | - |
| JC285_RS09370 (JC285_09370) | - | 2003409..2004101 (-) | 693 | WP_198462507.1 | hypothetical protein | - |
| JC285_RS09375 (JC285_09375) | - | 2004105..2005502 (-) | 1398 | WP_198462508.1 | phage tail protein | - |
| JC285_RS09380 (JC285_09380) | - | 2005515..2006447 (-) | 933 | WP_015728840.1 | phage tail family protein | - |
| JC285_RS09385 (JC285_09385) | - | 2006460..2009579 (-) | 3120 | WP_198462509.1 | phage tail protein | - |
| JC285_RS09390 (JC285_09390) | - | 2009596..2009946 (-) | 351 | WP_099997387.1 | hypothetical protein | - |
| JC285_RS09395 (JC285_09395) | - | 2009973..2010356 (-) | 384 | WP_099997386.1 | tail assembly chaperone | - |
| JC285_RS09400 (JC285_09400) | - | 2010414..2011067 (-) | 654 | WP_099997385.1 | phage major tail protein, TP901-1 family | - |
| JC285_RS09405 (JC285_09405) | - | 2011085..2011480 (-) | 396 | WP_198462510.1 | hypothetical protein | - |
| JC285_RS09410 (JC285_09410) | - | 2011490..2011840 (-) | 351 | WP_060830211.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| JC285_RS09415 (JC285_09415) | - | 2012141..2012473 (-) | 333 | WP_015728833.1 | phage head-tail connector protein | - |
| JC285_RS09420 (JC285_09420) | - | 2012485..2012934 (-) | 450 | WP_198462511.1 | Ig-like domain-containing protein | - |
| JC285_RS09425 (JC285_09425) | - | 2013024..2013935 (-) | 912 | WP_015728831.1 | hypothetical protein | - |
| JC285_RS09430 (JC285_09430) | - | 2013953..2014561 (-) | 609 | WP_096533875.1 | DUF4355 domain-containing protein | - |
| JC285_RS09435 (JC285_09435) | - | 2014714..2014908 (-) | 195 | WP_100002489.1 | LSM domain protein | - |
| JC285_RS09440 (JC285_09440) | - | 2014908..2016257 (-) | 1350 | WP_198462512.1 | minor capsid protein | - |
| JC285_RS09445 (JC285_09445) | - | 2016250..2017695 (-) | 1446 | WP_198462513.1 | phage portal protein | - |
| JC285_RS09450 (JC285_09450) | - | 2017707..2018981 (-) | 1275 | WP_037543597.1 | PBSX family phage terminase large subunit | - |
| JC285_RS09455 (JC285_09455) | - | 2018968..2019411 (-) | 444 | WP_115834485.1 | terminase small subunit | - |
| JC285_RS09460 (JC285_09460) | - | 2019710..2020129 (-) | 420 | WP_115834484.1 | transcriptional regulator | - |
| JC285_RS09465 (JC285_09465) | - | 2020129..2020278 (-) | 150 | WP_019166757.1 | hypothetical protein | - |
| JC285_RS09470 (JC285_09470) | - | 2020418..2020882 (-) | 465 | WP_198462514.1 | class I SAM-dependent methyltransferase | - |
| JC285_RS09475 (JC285_09475) | - | 2020919..2021455 (-) | 537 | WP_198462515.1 | dUTPase | - |
| JC285_RS09480 (JC285_09480) | - | 2021448..2021759 (-) | 312 | WP_114281691.1 | hypothetical protein | - |
| JC285_RS09485 (JC285_09485) | - | 2021771..2021932 (-) | 162 | WP_168429838.1 | hypothetical protein | - |
| JC285_RS09490 (JC285_09490) | - | 2021933..2022088 (-) | 156 | WP_157950554.1 | hypothetical protein | - |
| JC285_RS09495 (JC285_09495) | - | 2022102..2022923 (-) | 822 | WP_136084302.1 | site-specific DNA-methyltransferase | - |
| JC285_RS09500 (JC285_09500) | - | 2023117..2023503 (-) | 387 | WP_198462516.1 | hypothetical protein | - |
| JC285_RS09505 (JC285_09505) | - | 2023503..2023679 (-) | 177 | WP_198462517.1 | hypothetical protein | - |
| JC285_RS12520 | - | 2023649..2023861 (-) | 213 | WP_242061342.1 | hypothetical protein | - |
| JC285_RS09510 (JC285_09510) | - | 2023839..2024798 (-) | 960 | WP_198462518.1 | DNA cytosine methyltransferase | - |
| JC285_RS09515 (JC285_09515) | - | 2024805..2025056 (-) | 252 | WP_198462519.1 | SAV1978 family virulence-associated passenger protein | - |
| JC285_RS09520 (JC285_09520) | - | 2025053..2025532 (-) | 480 | WP_198462520.1 | DUF3310 domain-containing protein | - |
| JC285_RS09525 (JC285_09525) | - | 2025698..2026027 (-) | 330 | WP_198462521.1 | hypothetical protein | - |
| JC285_RS09530 (JC285_09530) | - | 2026040..2026258 (-) | 219 | WP_110159181.1 | hypothetical protein | - |
| JC285_RS09535 (JC285_09535) | - | 2026242..2026676 (-) | 435 | WP_110159182.1 | RusA family crossover junction endodeoxyribonuclease | - |
| JC285_RS09540 (JC285_09540) | - | 2026677..2026856 (-) | 180 | WP_110159183.1 | hypothetical protein | - |
| JC285_RS09545 (JC285_09545) | - | 2026850..2027611 (-) | 762 | WP_238402015.1 | ATP-binding protein | - |
| JC285_RS09550 (JC285_09550) | - | 2027631..2028401 (-) | 771 | WP_198462522.1 | conserved phage C-terminal domain-containing protein | - |
| JC285_RS09555 (JC285_09555) | - | 2028401..2029069 (-) | 669 | WP_198462523.1 | putative HNHc nuclease | - |
| JC285_RS09560 (JC285_09560) | ssbA | 2029253..2029690 (-) | 438 | WP_015728805.1 | single-stranded DNA-binding protein | Machinery gene |
| JC285_RS09565 (JC285_09565) | - | 2029690..2030358 (-) | 669 | WP_198462524.1 | ERF family protein | - |
| JC285_RS09570 (JC285_09570) | - | 2030360..2030908 (-) | 549 | WP_110165142.1 | host-nuclease inhibitor Gam family protein | - |
| JC285_RS09575 (JC285_09575) | - | 2030901..2031209 (-) | 309 | WP_110165141.1 | hypothetical protein | - |
| JC285_RS09580 (JC285_09580) | - | 2031221..2031481 (-) | 261 | WP_198462525.1 | DUF1108 family protein | - |
| JC285_RS09585 (JC285_09585) | - | 2031563..2031739 (-) | 177 | WP_198462526.1 | hypothetical protein | - |
| JC285_RS09590 (JC285_09590) | - | 2031727..2031951 (-) | 225 | WP_198462527.1 | hypothetical protein | - |
| JC285_RS09595 (JC285_09595) | - | 2031948..2032670 (-) | 723 | WP_198462528.1 | BRO family protein | - |
| JC285_RS09600 (JC285_09600) | - | 2032719..2033078 (+) | 360 | WP_198462529.1 | DUF2513 domain-containing protein | - |
| JC285_RS09605 (JC285_09605) | - | 2033070..2033264 (-) | 195 | WP_198462530.1 | hypothetical protein | - |
| JC285_RS09610 (JC285_09610) | - | 2033279..2033494 (-) | 216 | WP_065354506.1 | transcriptional regulator | - |
| JC285_RS09615 (JC285_09615) | - | 2033689..2034381 (+) | 693 | WP_198462531.1 | XRE family transcriptional regulator | - |
| JC285_RS09620 (JC285_09620) | - | 2034393..2034560 (+) | 168 | WP_198462532.1 | hypothetical protein | - |
| JC285_RS09625 (JC285_09625) | - | 2034573..2035010 (+) | 438 | WP_198462533.1 | hypothetical protein | - |
| JC285_RS09630 (JC285_09630) | - | 2035072..2036121 (+) | 1050 | WP_198462534.1 | site-specific integrase | - |
| JC285_RS09635 (JC285_09635) | sufB | 2036189..2037586 (-) | 1398 | WP_019166866.1 | Fe-S cluster assembly protein SufB | - |
Sequence
Protein
Download Length: 145 a.a. Molecular weight: 16466.13 Da Isoelectric Point: 4.9225
>NTDB_id=515266 JC285_RS09560 WP_015728805.1 2029253..2029690(-) (ssbA) [Staphylococcus pseudintermedius strain SP_11304-2A]
MINRVVLVGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKNNNQSNNQPQQQRGQAPAQDNPFTNANNPIDIDDEDLPF
MINRVVLVGRLTKDPEFRTTQSGVEVATFTLAVNRNYKNKNGEQQADFINCIVFRKQAENVNNYLNKGNLAGVDGRLQSR
SYENQEGRRIFVTEVICDSVQFLESKNNNQSNNQPQQQRGQAPAQDNPFTNANNPIDIDDEDLPF
Nucleotide
Download Length: 438 bp
>NTDB_id=515266 JC285_RS09560 WP_015728805.1 2029253..2029690(-) (ssbA) [Staphylococcus pseudintermedius strain SP_11304-2A]
ATGATCAACAGAGTCGTATTGGTAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAGCGTGCAATTTTTAGAGTCTAAAAA
TAACAATCAATCTAACAACCAACCACAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACGCAAATA
ATCCGATTGACATCGACGATGAAGATTTACCCTTTTGA
ATGATCAACAGAGTCGTATTGGTAGGTCGATTAACAAAAGACCCGGAATTCAGAACGACGCAATCAGGCGTGGAGGTAGC
AACATTTACATTGGCAGTTAACCGCAATTACAAAAATAAAAACGGAGAACAACAAGCAGACTTTATAAACTGTATTGTTT
TTCGTAAGCAAGCAGAAAATGTGAACAACTATCTAAATAAAGGAAATCTAGCTGGCGTTGATGGTCGCTTACAATCACGC
AGTTACGAAAACCAAGAAGGCCGACGTATATTCGTTACAGAAGTGATTTGTGATAGCGTGCAATTTTTAGAGTCTAAAAA
TAACAATCAATCTAACAACCAACCACAACAACAAAGAGGTCAAGCGCCTGCACAAGATAATCCATTCACTAACGCAAATA
ATCCGATTGACATCGACGATGAAGATTTACCCTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
55.814 |
100 |
0.662 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
51.765 |
100 |
0.607 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.604 |
73.103 |
0.414 |
| ssbA | Streptococcus mutans UA159 |
38.621 |
100 |
0.386 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
37.931 |
100 |
0.379 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
37.931 |
100 |
0.379 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
37.931 |
100 |
0.379 |
| ssb | Glaesserella parasuis strain SC1401 |
30.337 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
37.241 |
100 |
0.372 |
| ssbB/cilA | Streptococcus mitis SK321 |
37.241 |
100 |
0.372 |
| ssb | Vibrio cholerae strain A1552 |
30.636 |
100 |
0.366 |