Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | I5V48_RS10580 | Genome accession | NZ_CP065430 |
| Coordinates | 2246778..2247194 (-) | Length | 138 a.a. |
| NCBI ID | WP_174850415.1 | Uniprot ID | A0A7T1P6E8 |
| Organism | Streptococcus suis strain YZDH1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2225676..2259073 | 2246778..2247194 | within | 0 |
Gene organization within MGE regions
Location: 2225676..2259073
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I5V48_RS10440 (I5V48_10440) | - | 2225676..2226080 (-) | 405 | WP_024399138.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| I5V48_RS10445 (I5V48_10445) | - | 2226141..2226326 (-) | 186 | WP_029185622.1 | type II toxin-antitoxin system HicA family toxin | - |
| I5V48_RS10450 (I5V48_10450) | - | 2226509..2227930 (-) | 1422 | WP_043026720.1 | peptidoglycan amidohydrolase family protein | - |
| I5V48_RS10455 (I5V48_10455) | - | 2228018..2228263 (-) | 246 | WP_029172929.1 | phage holin | - |
| I5V48_RS10460 (I5V48_10460) | - | 2228267..2228692 (-) | 426 | WP_029172930.1 | hypothetical protein | - |
| I5V48_RS10465 (I5V48_10465) | - | 2228696..2228941 (-) | 246 | WP_029172931.1 | hypothetical protein | - |
| I5V48_RS10470 (I5V48_10470) | - | 2228944..2229156 (-) | 213 | WP_061631527.1 | hypothetical protein | - |
| I5V48_RS12115 | - | 2229165..2232311 (-) | 3147 | WP_061756372.1 | phage tail spike protein | - |
| I5V48_RS10485 (I5V48_10485) | - | 2232312..2233034 (-) | 723 | WP_172045804.1 | phage tail protein | - |
| I5V48_RS10490 (I5V48_10490) | - | 2233031..2235835 (-) | 2805 | WP_043024730.1 | phage tail tape measure protein | - |
| I5V48_RS10495 (I5V48_10495) | - | 2236024..2236497 (-) | 474 | WP_043024729.1 | hypothetical protein | - |
| I5V48_RS10500 (I5V48_10500) | - | 2236497..2237189 (-) | 693 | WP_043024728.1 | phage tail protein | - |
| I5V48_RS10505 (I5V48_10505) | - | 2237204..2237548 (-) | 345 | WP_043024727.1 | hypothetical protein | - |
| I5V48_RS10510 (I5V48_10510) | - | 2237535..2237882 (-) | 348 | WP_043024726.1 | hypothetical protein | - |
| I5V48_RS10515 (I5V48_10515) | - | 2237882..2238187 (-) | 306 | WP_043024725.1 | phage head closure protein | - |
| I5V48_RS10520 (I5V48_10520) | - | 2238184..2238519 (-) | 336 | WP_043024724.1 | hypothetical protein | - |
| I5V48_RS10525 (I5V48_10525) | - | 2238541..2239803 (-) | 1263 | WP_172073075.1 | phage major capsid protein | - |
| I5V48_RS10530 (I5V48_10530) | - | 2239816..2240358 (-) | 543 | WP_024398435.1 | HK97 family phage prohead protease | - |
| I5V48_RS12285 (I5V48_10535) | - | 2240409..2241551 (-) | 1143 | Protein_2063 | phage portal protein | - |
| I5V48_RS10540 (I5V48_10540) | - | 2241560..2243197 (-) | 1638 | WP_231640485.1 | terminase TerL endonuclease subunit | - |
| I5V48_RS10545 (I5V48_10545) | - | 2243265..2243750 (-) | 486 | WP_052496988.1 | hypothetical protein | - |
| I5V48_RS10550 (I5V48_10550) | - | 2243838..2244200 (-) | 363 | WP_174850416.1 | HNH endonuclease | - |
| I5V48_RS10555 (I5V48_10555) | - | 2244190..2244342 (-) | 153 | WP_153992263.1 | hypothetical protein | - |
| I5V48_RS10560 (I5V48_10560) | - | 2244625..2245167 (-) | 543 | WP_043024721.1 | site-specific integrase | - |
| I5V48_RS10565 (I5V48_10565) | - | 2245279..2245743 (-) | 465 | WP_043024720.1 | hypothetical protein | - |
| I5V48_RS10570 (I5V48_10570) | - | 2245709..2245954 (-) | 246 | WP_024398442.1 | hypothetical protein | - |
| I5V48_RS12225 | - | 2245923..2246057 (-) | 135 | WP_269434359.1 | hypothetical protein | - |
| I5V48_RS10575 (I5V48_10575) | - | 2246248..2246514 (-) | 267 | WP_043024718.1 | hypothetical protein | - |
| I5V48_RS10580 (I5V48_10580) | ssb | 2246778..2247194 (-) | 417 | WP_174850415.1 | single-stranded DNA-binding protein | Machinery gene |
| I5V48_RS10585 (I5V48_10585) | - | 2247198..2247461 (-) | 264 | WP_043024715.1 | helix-turn-helix domain-containing protein | - |
| I5V48_RS10590 (I5V48_10590) | - | 2247470..2247928 (-) | 459 | WP_043024714.1 | class I SAM-dependent methyltransferase | - |
| I5V48_RS10595 (I5V48_10595) | - | 2248056..2248277 (-) | 222 | WP_043024713.1 | hypothetical protein | - |
| I5V48_RS10600 (I5V48_10600) | - | 2248270..2248623 (-) | 354 | WP_197315057.1 | YopX family protein | - |
| I5V48_RS10605 (I5V48_10605) | - | 2248607..2248786 (-) | 180 | WP_043027195.1 | hypothetical protein | - |
| I5V48_RS10610 (I5V48_10610) | - | 2248786..2249358 (-) | 573 | WP_061844414.1 | DUF1642 domain-containing protein | - |
| I5V48_RS10615 (I5V48_10615) | - | 2249351..2249707 (-) | 357 | WP_043027197.1 | hypothetical protein | - |
| I5V48_RS10620 (I5V48_10620) | - | 2249712..2250029 (-) | 318 | WP_043025578.1 | hypothetical protein | - |
| I5V48_RS10625 (I5V48_10625) | - | 2250040..2250714 (-) | 675 | WP_043025580.1 | DNA methyltransferase | - |
| I5V48_RS10630 (I5V48_10630) | - | 2250767..2250832 (-) | 66 | Protein_2083 | DNA cytosine methyltransferase | - |
| I5V48_RS10635 (I5V48_10635) | - | 2251113..2251550 (-) | 438 | WP_043025581.1 | hypothetical protein | - |
| I5V48_RS10640 (I5V48_10640) | - | 2251614..2251781 (-) | 168 | WP_153308617.1 | hypothetical protein | - |
| I5V48_RS10645 (I5V48_10645) | - | 2251781..2251999 (-) | 219 | WP_043025582.1 | hypothetical protein | - |
| I5V48_RS10650 (I5V48_10650) | - | 2251987..2252721 (-) | 735 | WP_231640521.1 | DnaD domain protein | - |
| I5V48_RS10655 (I5V48_10655) | - | 2252771..2252935 (-) | 165 | WP_197315058.1 | hypothetical protein | - |
| I5V48_RS10660 (I5V48_10660) | - | 2252950..2253204 (-) | 255 | WP_172045802.1 | hypothetical protein | - |
| I5V48_RS10665 (I5V48_10665) | - | 2253206..2253394 (-) | 189 | WP_172045801.1 | hypothetical protein | - |
| I5V48_RS10670 (I5V48_10670) | - | 2253391..2253675 (-) | 285 | WP_043025587.1 | hypothetical protein | - |
| I5V48_RS10675 (I5V48_10675) | - | 2253736..2254200 (-) | 465 | WP_043025589.1 | hypothetical protein | - |
| I5V48_RS10680 (I5V48_10680) | - | 2254264..2254971 (-) | 708 | WP_172073135.1 | ORF6C domain-containing protein | - |
| I5V48_RS10685 (I5V48_10685) | - | 2255025..2255456 (+) | 432 | WP_029178370.1 | hypothetical protein | - |
| I5V48_RS12230 | - | 2255609..2255743 (-) | 135 | WP_256769127.1 | hypothetical protein | - |
| I5V48_RS10690 (I5V48_10690) | - | 2255736..2255933 (-) | 198 | WP_024405319.1 | hypothetical protein | - |
| I5V48_RS10695 (I5V48_10695) | - | 2255938..2256150 (-) | 213 | WP_043025601.1 | transcriptional regulator | - |
| I5V48_RS10700 (I5V48_10700) | - | 2256212..2256418 (+) | 207 | WP_024404519.1 | hypothetical protein | - |
| I5V48_RS10705 (I5V48_10705) | - | 2256430..2256630 (-) | 201 | WP_172073136.1 | hypothetical protein | - |
| I5V48_RS10710 (I5V48_10710) | - | 2257607..2257966 (+) | 360 | WP_172073137.1 | helix-turn-helix domain-containing protein | - |
| I5V48_RS10715 (I5V48_10715) | - | 2257976..2258197 (+) | 222 | WP_024399050.1 | DUF6290 family protein | - |
| I5V48_RS10720 (I5V48_10720) | - | 2258187..2258462 (+) | 276 | WP_024399051.1 | type II toxin-antitoxin system RelE family toxin | - |
| I5V48_RS10725 (I5V48_10725) | - | 2258525..2259073 (+) | 549 | WP_172120444.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15644.50 Da Isoelectric Point: 4.8836
>NTDB_id=509536 I5V48_RS10580 WP_174850415.1 2246778..2247194(-) (ssb) [Streptococcus suis strain YZDH1]
MINNIVLVGRLTRDVELRYTPSNQAVATFTSAVNRNFKNQATGEREADFINCVIWNKQAENLANWTKKGHLIGITGRIQT
RSYDNQQGQRVYVTEVVAESFQLLEKRDNTANYSSMDEQMPPCISGQPMDIDDDGLPF
MINNIVLVGRLTRDVELRYTPSNQAVATFTSAVNRNFKNQATGEREADFINCVIWNKQAENLANWTKKGHLIGITGRIQT
RSYDNQQGQRVYVTEVVAESFQLLEKRDNTANYSSMDEQMPPCISGQPMDIDDDGLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=509536 I5V48_RS10580 WP_174850415.1 2246778..2247194(-) (ssb) [Streptococcus suis strain YZDH1]
ATGATCAACAATATTGTTTTGGTTGGTAGATTGACGAGGGATGTAGAGCTACGTTATACACCGTCTAATCAAGCCGTTGC
GACTTTTACCTCGGCAGTTAACCGCAATTTTAAAAATCAAGCAACAGGAGAACGAGAAGCTGACTTTATCAATTGCGTTA
TTTGGAACAAGCAGGCTGAAAATTTAGCCAACTGGACCAAGAAAGGTCACTTGATTGGTATTACTGGACGAATCCAGACC
AGAAGCTACGATAACCAGCAAGGGCAACGTGTTTACGTTACTGAGGTAGTTGCTGAGAGCTTCCAGTTATTGGAAAAGCG
TGATAATACGGCAAATTATTCCAGCATGGATGAGCAGATGCCACCATGCATCAGCGGCCAGCCGATGGATATTGATGATG
ACGGATTGCCGTTTTAG
ATGATCAACAATATTGTTTTGGTTGGTAGATTGACGAGGGATGTAGAGCTACGTTATACACCGTCTAATCAAGCCGTTGC
GACTTTTACCTCGGCAGTTAACCGCAATTTTAAAAATCAAGCAACAGGAGAACGAGAAGCTGACTTTATCAATTGCGTTA
TTTGGAACAAGCAGGCTGAAAATTTAGCCAACTGGACCAAGAAAGGTCACTTGATTGGTATTACTGGACGAATCCAGACC
AGAAGCTACGATAACCAGCAAGGGCAACGTGTTTACGTTACTGAGGTAGTTGCTGAGAGCTTCCAGTTATTGGAAAAGCG
TGATAATACGGCAAATTATTCCAGCATGGATGAGCAGATGCCACCATGCATCAGCGGCCAGCCGATGGATATTGATGATG
ACGGATTGCCGTTTTAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.216 |
100 |
0.659 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.568 |
100 |
0.645 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.553 |
100 |
0.435 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.553 |
100 |
0.435 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.844 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.844 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.844 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.844 |
100 |
0.428 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
55.14 |
77.536 |
0.428 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
51.351 |
80.435 |
0.413 |
| ssb | Vibrio cholerae strain A1552 |
29.48 |
100 |
0.37 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
45.455 |
79.71 |
0.362 |
| ssbA | Streptococcus mutans UA159 |
45.045 |
80.435 |
0.362 |