Detailed information NTG0049196

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: INV104_RS10305
• Genome accession: NC_017591
• Coordinates: 1936027..1936353 (-)
• Length: 108 a.a.
• NCBI ID: WP_000738625.1
• Uniprot ID: -
• Organism: Streptococcus pneumoniae INV104
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1931027..1941353

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
INV104_RS10265 (INV104_17620)	comYH	1931170..1932123 (-)	954	WP_000345118.1	class I SAM-dependent methyltransferase	Machinery gene
INV104_RS12495	-	1932469..1933270 (+)	802	WP_128887635.1	IS5 family transposase	-
INV104_RS10280	-	1933421..1933897 (+)	477	WP_000777686.1	GNAT family N-acetyltransferase	-
INV104_RS10285 (INV104_17630)	comGG/cglG	1934571..1934963 (-)	393	WP_001818966.1	competence type IV pilus minor pilin ComGG	Machinery gene
INV104_RS10290 (INV104_17640)	comGF/cglF	1934941..1935402 (-)	462	WP_000250537.1	competence type IV pilus minor pilin ComGF	Machinery gene
INV104_RS10295 (INV104_17650)	comGE/cglE	1935365..1935667 (-)	303	WP_000413382.1	competence type IV pilus minor pilin ComGE	Machinery gene
INV104_RS10300 (INV104_17660)	comGD/cglD	1935630..1936034 (-)	405	WP_000588017.1	competence type IV pilus minor pilin ComGD	Machinery gene
INV104_RS10305 (INV104_17670)	comGC/cglC	1936027..1936353 (-)	327	WP_000738625.1	competence type IV pilus major pilin ComGC	Machinery gene
INV104_RS10310 (INV104_17680)	comGB/cglB	1936355..1937371 (-)	1017	WP_001844019.1	competence type IV pilus assembly protein ComGB	Machinery gene
INV104_RS10315 (INV104_17690)	comGA/cglA/cilD	1937319..1938260 (-)	942	WP_000249574.1	competence type IV pilus ATPase ComGA	Machinery gene
INV104_RS10320 (INV104_17700)	-	1938336..1938701 (-)	366	WP_000286415.1	DUF1033 family protein	-
INV104_RS10325 (INV104_17710)	-	1938852..1939910 (-)	1059	WP_000649471.1	zinc-dependent alcohol dehydrogenase family protein	-
INV104_RS10330 (INV104_17720)	nagA	1940073..1941224 (-)	1152	WP_001134457.1	N-acetylglucosamine-6-phosphate deacetylase	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12143.28 Da
• Isoelectric Point: 10.0055

>NTDB_id=49196 INV104_RS10305 WP_000738625.1 1936027..1936353(-) (comGC/cglC) [Streptococcus pneumoniae INV104]
MKKMMTFLKKAKVKAFTLVEMLVVLLIISVLFLLFVPNLTKQKEAVNDKGKAAVVKVVESQAELYSLDKNEDATLSKLQG
DGRITEEQVKAYNEYYTKNGGANRKVND

Nucleotide

• Length: 327 bp

>NTDB_id=49196 INV104_RS10305 WP_000738625.1 1936027..1936353(-) (comGC/cglC) [Streptococcus pneumoniae INV104]
ATGAAAAAAATGATGACATTCTTGAAAAAAGCTAAGGTTAAAGCTTTTACATTGGTGGAGATGTTGGTGGTCTTGCTGAT
TATCAGCGTGCTTTTCTTGCTCTTTGTACCTAATCTGACCAAGCAAAAAGAAGCAGTCAATGACAAAGGAAAAGCAGCTG
TTGTTAAGGTGGTGGAAAGCCAGGCAGAACTTTATAGCTTGGATAAAAATGAAGATGCTACTCTGAGCAAGTTACAAGGA
GATGGGCGCATCACGGAAGAACAGGTTAAAGCTTATAATGAATACTATACTAAAAATGGAGGGGCAAATCGTAAAGTCAA
TGATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-34)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus mitis SK321	95.37	100	0.954
comGC/cglC	Streptococcus pneumoniae Rx1	92.593	100	0.926
comGC/cglC	Streptococcus pneumoniae D39	92.593	100	0.926
comGC/cglC	Streptococcus pneumoniae R6	92.593	100	0.926
comGC/cglC	Streptococcus pneumoniae TIGR4	92.593	100	0.926
comGC/cglC	Streptococcus mitis NCTC 12261	92.857	90.741	0.843
comYC	Streptococcus gordonii str. Challis substr. CH1	67.961	95.37	0.648
comYC	Streptococcus mutans UA140	62.745	94.444	0.593
comYC	Streptococcus mutans UA159	62.745	94.444	0.593
comGC	Lactococcus lactis subsp. cremoris KW2	56.863	94.444	0.537
comYC	Streptococcus suis isolate S10	64.773	81.481	0.528
comGC	Staphylococcus aureus MW2	47.674	79.63	0.38
comGC	Staphylococcus aureus N315	47.674	79.63	0.38