Detailed information NTG0489197

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: IF777_RS07940
• Genome accession: NZ_CP062399
• Coordinates: 1632144..1632455 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain NAS_OP_143
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1627144..1637455

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
IF777_RS07905 (IF777_07865)	gcvPA	1627646..1628992 (-)	1347	WP_043854778.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
IF777_RS07910 (IF777_07870)	gcvT	1629012..1630103 (-)	1092	WP_240053219.1	glycine cleavage system aminomethyltransferase GcvT	-
IF777_RS07915 (IF777_07875)	-	1630262..1630786 (-)	525	WP_001015123.1	shikimate kinase	-
IF777_RS07920 (IF777_07880)	-	1630776..1630922 (-)	147	WP_001789879.1	hypothetical protein	-
IF777_RS07925 (IF777_07885)	comGF	1631019..1631516 (-)	498	WP_001829055.1	competence type IV pilus minor pilin ComGF	Machinery gene
IF777_RS07930 (IF777_07890)	comGE	1631434..1631733 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
IF777_RS07935 (IF777_07895)	comGD	1631720..1632166 (-)	447	WP_001788899.1	competence type IV pilus minor pilin ComGD	Machinery gene
IF777_RS07940 (IF777_07900)	comGC	1632144..1632455 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
IF777_RS07945 (IF777_07905)	comGB	1632469..1633539 (-)	1071	WP_000776406.1	competence type IV pilus assembly protein ComGB	Machinery gene
IF777_RS07950 (IF777_07910)	comGA	1633511..1634485 (-)	975	WP_000697227.1	competence type IV pilus ATPase ComGA	Machinery gene
IF777_RS07955 (IF777_07915)	-	1634537..1635160 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
IF777_RS07960 (IF777_07920)	-	1635157..1635486 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
IF777_RS07965 (IF777_07925)	-	1635486..1636472 (-)	987	WP_000161314.1	ROK family glucokinase	-
IF777_RS07970 (IF777_07930)	-	1636469..1636672 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=489197 IF777_RS07940 WP_000472256.1 1632144..1632455(-) (comGC) [Staphylococcus aureus strain NAS_OP_143]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=489197 IF777_RS07940 WP_000472256.1 1632144..1632455(-) (comGC) [Staphylococcus aureus strain NAS_OP_143]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369