NTDB

Overview

Name	pilA	Type	Machinery gene
Locus tag	IFJ77_RS06500	Genome accession	NZ_CP061780
Coordinates	1365105..1365554 (-)	Length	149 a.a.
NCBI ID	WP_021264133.1	Uniprot ID	A0A509JKL4
Organism	Pseudomonas aeruginosa strain ZBX-P11
Function	assembly of type IV pilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1360105..1370554

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
IFJ77_RS06480 (IFJ77_06480)	ampD	1360797..1361363 (-)	567	WP_003104911.1	1,6-anhydro-N-acetylmuramyl-L-alanine amidase AmpD	-
IFJ77_RS06485 (IFJ77_06485)	-	1361514..1363769 (-)	2256	WP_016264271.1	DUF1631 domain-containing protein	-
IFJ77_RS06490 (IFJ77_06490)	nadC	1364055..1364903 (+)	849	WP_021264134.1	carboxylating nicotinate-nucleotide diphosphorylase	-
IFJ77_RS06500 (IFJ77_06500)	pilA	1365105..1365554 (-)	450	WP_021264133.1	pilin	Machinery gene
IFJ77_RS06505 (IFJ77_06505)	pilB	1365786..1367486 (+)	1701	WP_021264132.1	type IV-A pilus assembly ATPase PilB	Machinery gene
IFJ77_RS06510 (IFJ77_06510)	pilC	1367490..1368710 (+)	1221	WP_023101565.1	type 4a pilus biogenesis protein PilC	Machinery gene
IFJ77_RS06515 (IFJ77_06515)	pilD	1368714..1369586 (+)	873	WP_021264129.1	type IV prepilin peptidase/methyltransferase PilD	Machinery gene
IFJ77_RS06520 (IFJ77_06520)	coaE	1369583..1370194 (+)	612	WP_003094654.1	dephospho-CoA kinase	-
IFJ77_RS06525 (IFJ77_06525)	yacG	1370191..1370391 (+)	201	WP_003094656.1	DNA gyrase inhibitor YacG	-

Sequence

Protein

Download Length: 149 a.a. Molecular weight: 15537.82 Da Isoelectric Point: 7.7818

                                >NTDB_id=484694 IFJ77_RS06500 WP_021264133.1 1365105..1365554(-) (pilA) [Pseudomonas aeruginosa strain ZBX-P11]

MKAQKGFTLIELMIVVAIIGILAAIAIPQYQNYVARSEGASALATINPLKTTVEESLSRGIAGTNIKIGTDPSTATETYV

GVAANANKLGLIDVKIADTGAGDITFTFQTGTSSPKNATKVITLNRTADGVWACKSTQDPMFTPKGCDN

Nucleotide

Download Length: 450 bp

                                >NTDB_id=484694 IFJ77_RS06500 WP_021264133.1 1365105..1365554(-) (pilA) [Pseudomonas aeruginosa strain ZBX-P11]

ATGAAAGCTCAAAAAGGCTTTACTTTGATCGAACTGATGATCGTGGTTGCGATCATCGGTATCCTGGCGGCGATTGCCAT

TCCCCAGTACCAGAACTATGTGGCGCGTTCGGAAGGTGCTTCGGCGCTGGCGACGATCAATCCGCTGAAGACCACTGTTG

AAGAGTCTCTGTCGCGTGGAATTGCTGGTACCAATATTAAAATTGGTACTGATCCATCTACTGCCACCGAAACATATGTT

GGGGTTGCTGCGAATGCCAACAAGCTGGGCTTGATTGATGTAAAGATTGCTGATACTGGTGCGGGTGATATTACCTTTAC

CTTCCAGACTGGTACTTCTAGTCCCAAGAATGCTACTAAAGTTATCACTCTGAATCGTACTGCGGATGGGGTCTGGGCTT

GTAAATCTACCCAGGATCCGATGTTCACTCCGAAAGGTTGTGATAACTAA

Domains

Predicted by InterproScan.

Pilin (bacterial filament) (Pilin)

(35-147)

Prokaryotic N-terminal methylation motif (N_methyl)

(1-26)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A509JKL4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
pilA	Pseudomonas aeruginosa PAK	68.667	100	0.691
pilA/pilAI	Pseudomonas stutzeri DSM 10701	46.358	100	0.47
pilA	Acinetobacter baumannii strain A118	47.297	99.329	0.47
comP	Acinetobacter baylyi ADP1	43.59	100	0.456
pilA	Vibrio cholerae C6706	42.949	100	0.45
pilA	Vibrio cholerae O1 biovar El Tor strain E7946	42.949	100	0.45
pilA	Vibrio cholerae strain A1552	42.949	100	0.45
pilA	Vibrio parahaemolyticus RIMD 2210633	45.578	98.658	0.45
pilA/pilAII	Pseudomonas stutzeri DSM 10701	45.455	95.973	0.436
pilA	Acinetobacter nosocomialis M2	41.429	93.96	0.389
pilA2	Legionella pneumophila str. Paris	39.189	99.329	0.389
pilA2	Legionella pneumophila strain ERS1305867	38.514	99.329	0.383

Detailed information NTG0484694