Detailed information NTG0479860

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: IAU62_RS05030
• Genome accession: NZ_CP061029
• Coordinates: 1040831..1041148 (-)
• Length: 105 a.a.
• NCBI ID: WP_002446532.1
• Uniprot ID: -
• Organism: Staphylococcus epidermidis strain Z0118SE0132
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1035831..1046148

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
IAU62_RS05000	gcvPA	1036357..1037703 (-)	1347	WP_099774518.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
IAU62_RS05005	gcvT	1037723..1038814 (-)	1092	WP_002446527.1	glycine cleavage system aminomethyltransferase GcvT	-
IAU62_RS05010	-	1039032..1039544 (-)	513	WP_002446528.1	shikimate kinase	-
IAU62_RS05015	comGF	1039709..1040200 (-)	492	WP_002446529.1	competence type IV pilus minor pilin ComGF	-
IAU62_RS05020	-	1040124..1040417 (-)	294	WP_002446530.1	hypothetical protein	-
IAU62_RS05025	comGD	1040404..1040841 (-)	438	WP_002446531.1	competence type IV pilus minor pilin ComGD	-
IAU62_RS05030	comGC	1040831..1041148 (-)	318	WP_002446532.1	competence type IV pilus major pilin ComGC	Machinery gene
IAU62_RS05035	comGB	1041166..1042233 (-)	1068	WP_002446533.1	competence type IV pilus assembly protein ComGB	Machinery gene
IAU62_RS05040	comGA	1042205..1043179 (-)	975	WP_002446534.1	competence type IV pilus ATPase ComGA	Machinery gene
IAU62_RS05045	-	1043236..1043859 (-)	624	WP_002446535.1	MBL fold metallo-hydrolase	-
IAU62_RS05050	-	1043859..1044185 (-)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
IAU62_RS05055	-	1044185..1045171 (-)	987	WP_002446536.1	ROK family glucokinase	-
IAU62_RS05060	-	1045171..1045371 (-)	201	WP_002446537.1	YqgQ family protein	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11491.53 Da
• Isoelectric Point: 9.2160

>NTDB_id=479860 IAU62_RS05030 WP_002446532.1 1040831..1041148(-) (comGC) [Staphylococcus epidermidis strain Z0118SE0132]
MKTLKLLKQTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=479860 IAU62_RS05030 WP_002446532.1 1040831..1041148(-) (comGC) [Staphylococcus epidermidis strain Z0118SE0132]
ATGAAAACATTGAAATTATTGAAACAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATCAGTTT
ATTATTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAACATAACCGCAACCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAGGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	86.275	97.143	0.838
comGC	Staphylococcus aureus N315	86.275	97.143	0.838
comGC/cglC	Streptococcus mitis SK321	43.689	98.095	0.429
comGC/cglC	Streptococcus pneumoniae R6	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae TIGR4	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae Rx1	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae D39	43.617	89.524	0.39
comYC	Streptococcus mutans UA159	47.674	81.905	0.39
comYC	Streptococcus suis isolate S10	47.674	81.905	0.39
comYC	Streptococcus mutans UA140	47.674	81.905	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC/cglC	Streptococcus mitis NCTC 12261	50	72.381	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	78.095	0.362