NTDB

Overview

Name	comYC	Type	Machinery gene
Locus tag	IBC03_RS09010	Genome accession	NZ_CP061025
Coordinates	1743066..1743392 (-)	Length	108 a.a.
NCBI ID	WP_002946126.1	Uniprot ID	A0A0E2Q1B3
Organism	Streptococcus thermophilus strain 13496
Function	dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1738066..1748392

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
IBC03_RS08975 (IBC03_08995)	-	1738386..1739579 (-)	1194	WP_014608740.1	acetate kinase	-
IBC03_RS08980 (IBC03_09000)	comYH	1739635..1740591 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
IBC03_RS08985 (IBC03_09005)	comGG	1740636..1740956 (-)	321	WP_278249177.1	competence type IV pilus minor pilin ComGG	-
IBC03_RS08990 (IBC03_09010)	-	1740977..1741912 (-)	936	WP_138496752.1	IS30 family transposase	-
IBC03_RS08995 (IBC03_09015)	comYF	1741995..1742429 (-)	435	WP_138496599.1	competence type IV pilus minor pilin ComGF	Machinery gene
IBC03_RS09000 (IBC03_09020)	comGE	1742413..1742706 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
IBC03_RS09005 (IBC03_09025)	comYD	1742678..1743106 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
IBC03_RS09010 (IBC03_09030)	comYC	1743066..1743392 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
IBC03_RS09015 (IBC03_09035)	comYB	1743389..1744489 (-)	1101	WP_116920398.1	competence type IV pilus assembly protein ComGB	Machinery gene
IBC03_RS09020 (IBC03_09040)	comGA/cglA/cilD	1744371..1745312 (-)	942	WP_014608745.1	competence type IV pilus ATPase ComGA	Machinery gene
IBC03_RS09025 (IBC03_09045)	-	1745393..1745755 (-)	363	WP_014608746.1	DUF1033 family protein	-

Sequence

Protein

Download Length: 108 a.a. Molecular weight: 11914.00 Da Isoelectric Point: 9.9219

                                >NTDB_id=479844 IBC03_RS09010 WP_002946126.1 1743066..1743392(-) (comYC) [Streptococcus thermophilus strain 13496]

MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS

EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

Download Length: 327 bp

                                >NTDB_id=479844 IBC03_RS09010 WP_002946126.1 1743066..1743392(-) (comYC) [Streptococcus thermophilus strain 13496]

ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTAGTACTTCTCAT

TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG

TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA

GAAGGTCAAATTACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC

CAATTAG

Domains

Predicted by InterproScan.

Prokaryotic N-terminal methylation motif (N_methyl)

(14-34)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	A0A0E2Q1B3

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361

Detailed information NTG0479844